Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1080376..1080997 Replicon chromosome
Accession NZ_CP098486
Organism Enterobacter hormaechei subsp. hormaechei strain ECC33

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag NDJ97_RS05140 Protein ID WP_015571250.1
Coordinates 1080376..1080594 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag NDJ97_RS05145 Protein ID WP_006809850.1
Coordinates 1080623..1080997 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDJ97_RS05110 (NDJ97_05110) 1076388..1076648 + 261 WP_015571255.1 type B 50S ribosomal protein L31 -
NDJ97_RS05115 (NDJ97_05115) 1076651..1076791 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
NDJ97_RS05120 (NDJ97_05120) 1076788..1077498 - 711 WP_022647267.1 GNAT family protein -
NDJ97_RS05125 (NDJ97_05125) 1077601..1079061 + 1461 WP_022647268.1 PLP-dependent aminotransferase family protein -
NDJ97_RS05130 (NDJ97_05130) 1079033..1079500 - 468 WP_022647269.1 YlaC family protein -
NDJ97_RS05135 (NDJ97_05135) 1079617..1080168 - 552 WP_022647270.1 maltose O-acetyltransferase -
NDJ97_RS05140 (NDJ97_05140) 1080376..1080594 - 219 WP_015571250.1 HHA domain-containing protein Toxin
NDJ97_RS05145 (NDJ97_05145) 1080623..1080997 - 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
NDJ97_RS05150 (NDJ97_05150) 1081507..1084653 - 3147 WP_022647271.1 multidrug efflux RND transporter permease subunit AcrB -
NDJ97_RS05155 (NDJ97_05155) 1084676..1085869 - 1194 WP_022647272.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T247693 WP_015571250.1 NZ_CP098486:c1080594-1080376 [Enterobacter hormaechei subsp. hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT247693 WP_006809850.1 NZ_CP098486:c1080997-1080623 [Enterobacter hormaechei subsp. hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References