Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 319587..320235 | Replicon | chromosome |
Accession | NZ_CP098483 | ||
Organism | Stenotrophomonas maltophilia strain 142 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | B2FJ07 |
Locus tag | NDK23_RS01425 | Protein ID | WP_012478870.1 |
Coordinates | 319587..319874 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NDK23_RS01430 | Protein ID | WP_012478871.1 |
Coordinates | 319933..320235 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDK23_RS01395 (NDK23_01395) | 314847..315815 | + | 969 | WP_012478821.1 | bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA | - |
NDK23_RS01400 (NDK23_01400) | 315812..316543 | + | 732 | WP_005407698.1 | type III pantothenate kinase | - |
NDK23_RS01405 (NDK23_01405) | 316553..317401 | + | 849 | WP_012478822.1 | SPOR domain-containing protein | - |
NDK23_RS01415 (NDK23_01415) | 317602..318726 | - | 1125 | WP_012478868.1 | hypothetical protein | - |
NDK23_RS01420 (NDK23_01420) | 318754..319353 | - | 600 | WP_012478869.1 | hypothetical protein | - |
NDK23_RS01425 (NDK23_01425) | 319587..319874 | + | 288 | WP_012478870.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NDK23_RS01430 (NDK23_01430) | 319933..320235 | + | 303 | WP_012478871.1 | putative addiction module antidote protein | Antitoxin |
NDK23_RS01435 (NDK23_01435) | 320293..320616 | - | 324 | WP_012478872.1 | hypothetical protein | - |
NDK23_RS01440 (NDK23_01440) | 320696..321103 | - | 408 | WP_044569408.1 | hypothetical protein | - |
NDK23_RS01445 (NDK23_01445) | 321697..322467 | + | 771 | WP_012478874.1 | DUF3011 domain-containing protein | - |
NDK23_RS01450 (NDK23_01450) | 322506..323471 | + | 966 | WP_224481934.1 | ankyrin repeat domain-containing protein | - |
NDK23_RS01455 (NDK23_01455) | 323576..324496 | + | 921 | WP_005407709.1 | arginase | - |
NDK23_RS01460 (NDK23_01460) | 324657..324794 | + | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
NDK23_RS01465 (NDK23_01465) | 325002..325223 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10802.42 Da Isoelectric Point: 10.8940
>T247691 WP_012478870.1 NZ_CP098483:319587-319874 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLGDGISELRIDAGPGYRLYYTQRGRQLLILLVGGDKSS
QQRDIEKAREIARAL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLGDGISELRIDAGPGYRLYYTQRGRQLLILLVGGDKSS
QQRDIEKAREIARAL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|