Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3139233..3139882 | Replicon | chromosome |
Accession | NZ_CP098480 | ||
Organism | Acinetobacter sp. C32I |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NDN13_RS14945 | Protein ID | WP_251116026.1 |
Coordinates | 3139463..3139882 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NDN13_RS14940 | Protein ID | WP_251116025.1 |
Coordinates | 3139233..3139463 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDN13_RS14930 (NDN13_14925) | 3135227..3136384 | + | 1158 | WP_004656677.1 | 2-methylcitrate synthase | - |
NDN13_RS14935 (NDN13_14930) | 3136384..3139002 | + | 2619 | WP_004656675.1 | Fe/S-dependent 2-methylisocitrate dehydratase AcnD | - |
NDN13_RS14940 (NDN13_14935) | 3139233..3139463 | + | 231 | WP_251116025.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NDN13_RS14945 (NDN13_14940) | 3139463..3139882 | + | 420 | WP_251116026.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NDN13_RS14950 (NDN13_14945) | 3140013..3140156 | + | 144 | WP_004637424.1 | zinc ribbon-containing protein | - |
NDN13_RS14955 (NDN13_14950) | 3140284..3140859 | + | 576 | WP_251118245.1 | DUF4126 domain-containing protein | - |
NDN13_RS14960 (NDN13_14955) | 3140902..3141603 | + | 702 | WP_251116027.1 | hypothetical protein | - |
NDN13_RS14965 (NDN13_14960) | 3141732..3142433 | + | 702 | WP_251116028.1 | hypothetical protein | - |
NDN13_RS14970 (NDN13_14965) | 3142506..3143393 | + | 888 | WP_251116029.1 | EamA family transporter | - |
NDN13_RS14975 (NDN13_14970) | 3143964..3144416 | + | 453 | WP_251116030.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15959.19 Da Isoelectric Point: 6.3313
>T247689 WP_251116026.1 NZ_CP098480:3139463-3139882 [Acinetobacter sp. C32I]
MQTQYLLDTNICIYISKHQPESVRQHFEKHLPNRNILISVITLGELRFGAEKSQSKEKALKVIDEFISMIQVAELDEDVA
DHYAQIRQALSSKGQIIGSNDLWLAAHARANNWVMVTNNEKEFLRVDGLRVENWVSTPL
MQTQYLLDTNICIYISKHQPESVRQHFEKHLPNRNILISVITLGELRFGAEKSQSKEKALKVIDEFISMIQVAELDEDVA
DHYAQIRQALSSKGQIIGSNDLWLAAHARANNWVMVTNNEKEFLRVDGLRVENWVSTPL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|