Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2555184..2555823 | Replicon | chromosome |
| Accession | NZ_CP098480 | ||
| Organism | Acinetobacter sp. C32I | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NDN13_RS12150 | Protein ID | WP_251115647.1 |
| Coordinates | 2555184..2555573 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | NDN13_RS12155 | Protein ID | WP_065343283.1 |
| Coordinates | 2555566..2555823 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDN13_RS12130 (NDN13_12125) | 2550259..2552469 | - | 2211 | WP_251115644.1 | TRAP transporter large permease subunit | - |
| NDN13_RS12135 (NDN13_12130) | 2552624..2553193 | - | 570 | WP_251115645.1 | rhombosortase | - |
| NDN13_RS12140 (NDN13_12135) | 2553271..2554410 | - | 1140 | WP_251115646.1 | hypothetical protein | - |
| NDN13_RS12145 (NDN13_12140) | 2554770..2554976 | - | 207 | WP_016660141.1 | hypothetical protein | - |
| NDN13_RS12150 (NDN13_12145) | 2555184..2555573 | - | 390 | WP_251115647.1 | hypothetical protein | Toxin |
| NDN13_RS12155 (NDN13_12150) | 2555566..2555823 | - | 258 | WP_065343283.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| NDN13_RS12160 (NDN13_12155) | 2556012..2557184 | + | 1173 | WP_251115648.1 | acyl-CoA dehydrogenase family protein | - |
| NDN13_RS12165 (NDN13_12160) | 2557230..2557724 | - | 495 | WP_251115649.1 | DUF2059 domain-containing protein | - |
| NDN13_RS12170 (NDN13_12165) | 2557848..2559338 | - | 1491 | WP_251115650.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NDN13_RS12175 (NDN13_12170) | 2559688..2560185 | - | 498 | WP_251115651.1 | GNAT family N-acetyltransferase | - |
| NDN13_RS12180 (NDN13_12175) | 2560341..2560706 | - | 366 | WP_004641032.1 | 50S ribosomal protein L17 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15774.86 Da Isoelectric Point: 10.1053
>T247688 WP_251115647.1 NZ_CP098480:c2555573-2555184 [Acinetobacter sp. C32I]
MANPAFELQYSRFAFVLQLLLFILILSVLYPLLPLWWWLLSFMLMTIAWLSFLRQPQIKRFEYLDHQDCSFEFSDPTLKI
QRRQIVKILDHQLYIALYFSQQKHKTCIIWWDQLSHAQWKKLKLRAKLA
MANPAFELQYSRFAFVLQLLLFILILSVLYPLLPLWWWLLSFMLMTIAWLSFLRQPQIKRFEYLDHQDCSFEFSDPTLKI
QRRQIVKILDHQLYIALYFSQQKHKTCIIWWDQLSHAQWKKLKLRAKLA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|