Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 447493..448132 | Replicon | chromosome |
| Accession | NZ_CP098479 | ||
| Organism | Acinetobacter sp. C26G | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NDN12_RS02165 | Protein ID | WP_251111469.1 |
| Coordinates | 447743..448132 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | N8XN48 |
| Locus tag | NDN12_RS02160 | Protein ID | WP_004804137.1 |
| Coordinates | 447493..447750 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDN12_RS02140 (NDN12_02140) | 443114..443632 | + | 519 | WP_251110639.1 | tetratricopeptide repeat protein | - |
| NDN12_RS02145 (NDN12_02145) | 443966..445456 | + | 1491 | WP_004804131.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NDN12_RS02150 (NDN12_02150) | 445583..446083 | + | 501 | WP_251110640.1 | DUF2059 domain-containing protein | - |
| NDN12_RS02155 (NDN12_02155) | 446133..447305 | - | 1173 | WP_167248702.1 | acyl-CoA dehydrogenase family protein | - |
| NDN12_RS02160 (NDN12_02160) | 447493..447750 | + | 258 | WP_004804137.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| NDN12_RS02165 (NDN12_02165) | 447743..448132 | + | 390 | WP_251111469.1 | hypothetical protein | Toxin |
| NDN12_RS02170 (NDN12_02170) | 448340..448546 | + | 207 | WP_167248705.1 | hypothetical protein | - |
| NDN12_RS02175 (NDN12_02175) | 448906..450021 | + | 1116 | WP_251110641.1 | hypothetical protein | - |
| NDN12_RS02180 (NDN12_02180) | 450097..450678 | + | 582 | WP_167248707.1 | rhombosortase | - |
| NDN12_RS02185 (NDN12_02185) | 450858..453062 | + | 2205 | WP_167248708.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15649.70 Da Isoelectric Point: 9.7340
>T247687 WP_251111469.1 NZ_CP098479:447743-448132 [Acinetobacter sp. C26G]
MANGVFELQRSRFAMVLQLLIFIAILSLTYSLLALWIWLLCFCMMGAAWILFLKQPQIKRFEYLDHQECSFEFYDPELKI
QRRKIVKILDHKFYIALYFSHSNQRTCIIWWDQLSHSQWQKLKLRAKLA
MANGVFELQRSRFAMVLQLLIFIAILSLTYSLLALWIWLLCFCMMGAAWILFLKQPQIKRFEYLDHQECSFEFYDPELKI
QRRKIVKILDHKFYIALYFSHSNQRTCIIWWDQLSHSQWQKLKLRAKLA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|