Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 447492..448131 | Replicon | chromosome |
Accession | NZ_CP098478 | ||
Organism | Acinetobacter sp. C26M |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NDN11_RS02165 | Protein ID | WP_251111469.1 |
Coordinates | 447742..448131 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | N8XN48 |
Locus tag | NDN11_RS02160 | Protein ID | WP_004804137.1 |
Coordinates | 447492..447749 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDN11_RS02140 (NDN11_02140) | 443113..443631 | + | 519 | WP_251110639.1 | tetratricopeptide repeat protein | - |
NDN11_RS02145 (NDN11_02145) | 443965..445455 | + | 1491 | WP_004804131.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NDN11_RS02150 (NDN11_02150) | 445582..446082 | + | 501 | WP_251110640.1 | DUF2059 domain-containing protein | - |
NDN11_RS02155 (NDN11_02155) | 446132..447304 | - | 1173 | WP_167248702.1 | acyl-CoA dehydrogenase family protein | - |
NDN11_RS02160 (NDN11_02160) | 447492..447749 | + | 258 | WP_004804137.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
NDN11_RS02165 (NDN11_02165) | 447742..448131 | + | 390 | WP_251111469.1 | hypothetical protein | Toxin |
NDN11_RS02170 (NDN11_02170) | 448339..448545 | + | 207 | WP_167248705.1 | hypothetical protein | - |
NDN11_RS02175 (NDN11_02175) | 448905..450020 | + | 1116 | WP_251110641.1 | hypothetical protein | - |
NDN11_RS02180 (NDN11_02180) | 450096..450677 | + | 582 | WP_167248707.1 | rhombosortase | - |
NDN11_RS02185 (NDN11_02185) | 450857..453061 | + | 2205 | WP_167248708.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15649.70 Da Isoelectric Point: 9.7340
>T247686 WP_251111469.1 NZ_CP098478:447742-448131 [Acinetobacter sp. C26M]
MANGVFELQRSRFAMVLQLLIFIAILSLTYSLLALWIWLLCFCMMGAAWILFLKQPQIKRFEYLDHQECSFEFYDPELKI
QRRKIVKILDHKFYIALYFSHSNQRTCIIWWDQLSHSQWQKLKLRAKLA
MANGVFELQRSRFAMVLQLLIFIAILSLTYSLLALWIWLLCFCMMGAAWILFLKQPQIKRFEYLDHQECSFEFYDPELKI
QRRKIVKILDHKFYIALYFSHSNQRTCIIWWDQLSHSQWQKLKLRAKLA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|