Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1642126..1642811 Replicon chromosome
Accession NZ_CP098474
Organism Neisseria gonorrhoeae strain 10239

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NC847_RS08555 Protein ID WP_003689143.1
Coordinates 1642629..1642811 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NC847_RS08550 Protein ID WP_003691454.1
Coordinates 1642126..1642527 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NC847_RS08510 (NC847_08445) 1637542..1637724 - 183 WP_260236894.1 hypothetical protein -
NC847_RS08515 (NC847_08450) 1637864..1638550 - 687 WP_263055815.1 hypothetical protein -
NC847_RS08520 (NC847_08455) 1638619..1638780 - 162 WP_047924242.1 hypothetical protein -
NC847_RS08525 (NC847_08460) 1638777..1639052 - 276 WP_003695501.1 hypothetical protein -
NC847_RS08530 (NC847_08465) 1639205..1639537 - 333 WP_003687946.1 hypothetical protein -
NC847_RS08535 (NC847_08470) 1639678..1639872 - 195 WP_003703103.1 hypothetical protein -
NC847_RS08540 (NC847_08475) 1640084..1640845 + 762 WP_012503753.1 hypothetical protein -
NC847_RS08545 (NC847_08480) 1641359..1641994 - 636 WP_225602681.1 Panacea domain-containing protein -
NC847_RS08550 (NC847_08485) 1642126..1642527 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NC847_RS08555 (NC847_08490) 1642629..1642811 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NC847_RS08560 (NC847_08495) 1642981..1643811 - 831 WP_229505546.1 DUF3037 domain-containing protein -
NC847_RS08565 (NC847_08500) 1644074..1644829 - 756 WP_003693472.1 LexA family transcriptional regulator -
NC847_RS08570 (NC847_08505) 1644966..1645151 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NC847_RS08575 (NC847_08510) 1645240..1645395 + 156 WP_003703527.1 hypothetical protein -
NC847_RS08580 (NC847_08515) 1645735..1645962 + 228 WP_003691442.1 helix-turn-helix domain-containing protein -
NC847_RS08585 (NC847_08520) 1645959..1646444 + 486 WP_260236988.1 helix-turn-helix domain-containing protein -
NC847_RS08590 (NC847_08525) 1646441..1646947 + 507 WP_260236987.1 hypothetical protein -
NC847_RS08595 (NC847_08530) 1646961..1647740 + 780 WP_146711208.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1626558..1659629 33071


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247684 WP_003689143.1 NZ_CP098474:c1642811-1642629 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247684 WP_003691454.1 NZ_CP098474:c1642527-1642126 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References