Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1520983..1521668 Replicon chromosome
Accession NZ_CP098472
Organism Neisseria gonorrhoeae strain 10612

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NC855_RS07880 Protein ID WP_003689143.1
Coordinates 1521486..1521668 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NC855_RS07875 Protein ID WP_003691454.1
Coordinates 1520983..1521384 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NC855_RS07835 (NC855_07755) 1516401..1516583 - 183 WP_003691535.1 hypothetical protein -
NC855_RS07840 (NC855_11820) 1516723..1517409 - 687 WP_010357532.1 hypothetical protein -
NC855_RS07845 (NC855_07770) 1517478..1517639 - 162 WP_003691530.1 hypothetical protein -
NC855_RS07850 (NC855_07775) 1517636..1517911 - 276 WP_151266294.1 hypothetical protein -
NC855_RS07855 (NC855_07780) 1518064..1518396 - 333 WP_047923919.1 hypothetical protein -
NC855_RS07860 (NC855_07785) 1518942..1519703 + 762 WP_012503753.1 hypothetical protein -
NC855_RS07865 (NC855_07790) 1519792..1520208 - 417 WP_003700378.1 hypothetical protein -
NC855_RS07870 (NC855_07795) 1520217..1520801 - 585 WP_003693477.1 Panacea domain-containing protein -
NC855_RS07875 (NC855_07800) 1520983..1521384 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NC855_RS07880 (NC855_07805) 1521486..1521668 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NC855_RS07885 (NC855_07810) 1521838..1522656 - 819 WP_003693474.1 DUF3037 domain-containing protein -
NC855_RS07890 (NC855_07815) 1522931..1523686 - 756 WP_003693472.1 LexA family transcriptional regulator -
NC855_RS07895 (NC855_07820) 1523823..1524008 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NC855_RS07900 (NC855_07825) 1524097..1524252 + 156 WP_003698902.1 hypothetical protein -
NC855_RS07905 (NC855_07830) 1524229..1524417 - 189 WP_003691445.1 hypothetical protein -
NC855_RS07910 (NC855_07835) 1524590..1524817 + 228 WP_003691442.1 helix-turn-helix domain-containing protein -
NC855_RS07915 (NC855_07840) 1524814..1525824 + 1011 WP_229931731.1 helix-turn-helix domain-containing protein -
NC855_RS07920 (NC855_07845) 1525839..1526618 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1507124..1540375 33251


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247681 WP_003689143.1 NZ_CP098472:c1521668-1521486 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247681 WP_003691454.1 NZ_CP098472:c1521384-1520983 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References