Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1631299..1631984 | Replicon | chromosome |
| Accession | NZ_CP098470 | ||
| Organism | Neisseria gonorrhoeae strain 10792 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NC854_RS08485 | Protein ID | WP_003689143.1 |
| Coordinates | 1631802..1631984 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NC854_RS08480 | Protein ID | WP_003691454.1 |
| Coordinates | 1631299..1631700 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC854_RS08435 (NC854_08340) | 1626714..1626896 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NC854_RS08440 (NC854_08345) | 1627036..1627722 | - | 687 | WP_042758540.1 | hypothetical protein | - |
| NC854_RS08445 (NC854_08350) | 1627791..1627952 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| NC854_RS08450 (NC854_08355) | 1627949..1628227 | - | 279 | WP_041421244.1 | hypothetical protein | - |
| NC854_RS08455 (NC854_08360) | 1628380..1628712 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NC854_RS08460 (NC854_08365) | 1628853..1629017 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| NC854_RS08465 (NC854_08370) | 1629258..1630019 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NC854_RS08470 (NC854_08375) | 1630108..1630452 | - | 345 | WP_229931773.1 | hypothetical protein | - |
| NC854_RS08475 (NC854_08380) | 1630533..1631117 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| NC854_RS08480 (NC854_08385) | 1631299..1631700 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NC854_RS08485 (NC854_08390) | 1631802..1631984 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NC854_RS08490 (NC854_08395) | 1632154..1632972 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NC854_RS08495 (NC854_08400) | 1633247..1634002 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NC854_RS08500 (NC854_08405) | 1634139..1634324 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NC854_RS08505 (NC854_08410) | 1634413..1634568 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| NC854_RS08510 (NC854_08415) | 1634545..1634733 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| NC854_RS08515 (NC854_08420) | 1634906..1635133 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| NC854_RS08520 (NC854_08425) | 1635130..1635642 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| NC854_RS08525 (NC854_08430) | 1635656..1636174 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| NC854_RS08530 (NC854_08435) | 1636189..1636968 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1615731..1649080 | 33349 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247678 WP_003689143.1 NZ_CP098470:c1631984-1631802 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247678 WP_003691454.1 NZ_CP098470:c1631700-1631299 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|