Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1631054..1631739 | Replicon | chromosome |
| Accession | NZ_CP098468 | ||
| Organism | Neisseria gonorrhoeae strain 10328 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NC853_RS08440 | Protein ID | WP_003689143.1 |
| Coordinates | 1631557..1631739 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NC853_RS08435 | Protein ID | WP_003691454.1 |
| Coordinates | 1631054..1631455 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC853_RS08390 (NC853_08310) | 1626469..1626651 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NC853_RS08395 (NC853_08315) | 1626791..1627477 | - | 687 | WP_042758540.1 | hypothetical protein | - |
| NC853_RS08400 (NC853_08320) | 1627546..1627707 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| NC853_RS08405 (NC853_08325) | 1627704..1627982 | - | 279 | WP_041421244.1 | hypothetical protein | - |
| NC853_RS08410 (NC853_08330) | 1628135..1628467 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NC853_RS08415 (NC853_08335) | 1628608..1628772 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| NC853_RS08420 (NC853_08340) | 1629013..1629774 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NC853_RS08425 (NC853_08345) | 1629863..1630279 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| NC853_RS08430 (NC853_08350) | 1630288..1630872 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| NC853_RS08435 (NC853_08355) | 1631054..1631455 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NC853_RS08440 (NC853_08360) | 1631557..1631739 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NC853_RS08445 (NC853_08365) | 1631909..1632727 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NC853_RS08450 (NC853_08370) | 1633002..1633757 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NC853_RS08455 (NC853_08375) | 1633894..1634079 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NC853_RS08460 (NC853_08380) | 1634168..1634323 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| NC853_RS08465 (NC853_08385) | 1634300..1634488 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| NC853_RS08470 (NC853_08390) | 1634661..1634888 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| NC853_RS08475 (NC853_08395) | 1634885..1635397 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| NC853_RS08480 (NC853_08400) | 1635411..1635929 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| NC853_RS08485 (NC853_08405) | 1635944..1636723 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1615486..1648835 | 33349 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247675 WP_003689143.1 NZ_CP098468:c1631739-1631557 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247675 WP_003691454.1 NZ_CP098468:c1631455-1631054 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|