Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1634708..1635393 Replicon chromosome
Accession NZ_CP098464
Organism Neisseria gonorrhoeae strain 10269

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NC851_RS08500 Protein ID WP_003689143.1
Coordinates 1635211..1635393 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NC851_RS08495 Protein ID WP_003691454.1
Coordinates 1634708..1635109 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NC851_RS08455 (NC851_08385) 1630126..1630308 - 183 WP_003691535.1 hypothetical protein -
NC851_RS08460 (NC851_08390) 1630448..1631134 - 687 WP_010357532.1 hypothetical protein -
NC851_RS08465 (NC851_08395) 1631203..1631364 - 162 WP_003691530.1 hypothetical protein -
NC851_RS08470 (NC851_08400) 1631361..1631636 - 276 WP_033911205.1 hypothetical protein -
NC851_RS08475 (NC851_08405) 1631789..1632121 - 333 WP_003695500.1 hypothetical protein -
NC851_RS08480 (NC851_08410) 1632667..1633428 + 762 WP_012503753.1 hypothetical protein -
NC851_RS08485 (NC851_08415) 1633517..1633933 - 417 WP_003700378.1 hypothetical protein -
NC851_RS08490 (NC851_08420) 1633942..1634526 - 585 WP_003693477.1 Panacea domain-containing protein -
NC851_RS08495 (NC851_08425) 1634708..1635109 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NC851_RS08500 (NC851_08430) 1635211..1635393 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NC851_RS08505 (NC851_08435) 1635563..1636381 - 819 WP_003693474.1 DUF3037 domain-containing protein -
NC851_RS08510 (NC851_08440) 1636656..1637411 - 756 WP_003693472.1 LexA family transcriptional regulator -
NC851_RS08515 (NC851_08445) 1637548..1637733 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NC851_RS08520 (NC851_08450) 1637822..1637977 + 156 WP_003698902.1 hypothetical protein -
NC851_RS08525 (NC851_08455) 1637954..1638142 - 189 WP_003691445.1 hypothetical protein -
NC851_RS08530 (NC851_08460) 1638315..1638542 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
NC851_RS08535 (NC851_08465) 1638539..1639006 + 468 WP_229433445.1 helix-turn-helix domain-containing protein -
NC851_RS08540 (NC851_08470) 1639020..1639550 + 531 WP_229931507.1 hypothetical protein -
NC851_RS08545 (NC851_08475) 1639565..1640344 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1619143..1652444 33301


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247670 WP_003689143.1 NZ_CP098464:c1635393-1635211 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247670 WP_003691454.1 NZ_CP098464:c1635109-1634708 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References