Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 950624..951279 | Replicon | chromosome |
Accession | NZ_CP098464 | ||
Organism | Neisseria gonorrhoeae strain 10269 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NC851_RS04915 | Protein ID | WP_229931500.1 |
Coordinates | 950624..951043 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NC851_RS04920 | Protein ID | WP_003688410.1 |
Coordinates | 951043..951279 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NC851_RS04895 (NC851_04850) | 945858..947399 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
NC851_RS04900 (NC851_04855) | 947547..948326 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NC851_RS04905 (NC851_04860) | 948323..949024 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
NC851_RS04910 (NC851_04865) | 949021..950475 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NC851_RS04915 (NC851_04870) | 950624..951043 | - | 420 | WP_229931500.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NC851_RS04920 (NC851_04875) | 951043..951279 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NC851_RS04925 (NC851_04880) | 951726..952304 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
NC851_RS04930 (NC851_04885) | 952309..952710 | - | 402 | WP_020996834.1 | helix-turn-helix domain-containing protein | - |
NC851_RS04935 (NC851_04890) | 952949..953335 | + | 387 | Protein_969 | IS110 family transposase | - |
NC851_RS04940 (NC851_04895) | 953718..954608 | - | 891 | WP_229931474.1 | succinate--CoA ligase subunit alpha | - |
NC851_RS04945 (NC851_04900) | 954619..955785 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NC851_RS04950 (NC851_04905) | 955857..956144 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15336.67 Da Isoelectric Point: 5.5742
>T247669 WP_229931500.1 NZ_CP098464:c951043-950624 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|