Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1643486..1644171 Replicon chromosome
Accession NZ_CP098462
Organism Neisseria gonorrhoeae strain 9460

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NC849_RS08545 Protein ID WP_003689143.1
Coordinates 1643989..1644171 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NC849_RS08540 Protein ID WP_003691454.1
Coordinates 1643486..1643887 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NC849_RS08500 (NC849_08440) 1638899..1639081 - 183 WP_260236894.1 hypothetical protein -
NC849_RS08505 (NC849_08445) 1639221..1639907 - 687 WP_042758540.1 hypothetical protein -
NC849_RS08510 (NC849_08450) 1639976..1640137 - 162 WP_003702497.1 hypothetical protein -
NC849_RS08515 (NC849_08455) 1640134..1640412 - 279 WP_003691529.1 hypothetical protein -
NC849_RS08520 (NC849_08460) 1640565..1640897 - 333 WP_003687946.1 hypothetical protein -
NC849_RS08525 (NC849_08465) 1641038..1641232 - 195 WP_003703103.1 hypothetical protein -
NC849_RS08530 (NC849_08470) 1641444..1642205 + 762 WP_012503753.1 hypothetical protein -
NC849_RS08535 (NC849_08475) 1642719..1643303 - 585 WP_003693477.1 Panacea domain-containing protein -
NC849_RS08540 (NC849_08480) 1643486..1643887 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NC849_RS08545 (NC849_08485) 1643989..1644171 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NC849_RS08550 (NC849_08490) 1644341..1645171 - 831 WP_260245424.1 DUF3037 domain-containing protein -
NC849_RS08555 (NC849_08495) 1645434..1646189 - 756 WP_003693472.1 LexA family transcriptional regulator -
NC849_RS08560 (NC849_08500) 1646326..1646511 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NC849_RS08565 (NC849_08505) 1646600..1646755 + 156 WP_003703527.1 hypothetical protein -
NC849_RS08570 (NC849_08510) 1647095..1647322 + 228 WP_003691442.1 helix-turn-helix domain-containing protein -
NC849_RS08575 (NC849_08515) 1647319..1647804 + 486 WP_260236988.1 helix-turn-helix domain-containing protein -
NC849_RS08580 (NC849_08520) 1647801..1648307 + 507 WP_260236987.1 hypothetical protein -
NC849_RS08585 (NC849_08525) 1648321..1649100 + 780 WP_235271184.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1627915..1660986 33071


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247668 WP_003689143.1 NZ_CP098462:c1644171-1643989 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247668 WP_003691454.1 NZ_CP098462:c1643887-1643486 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References