Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 661248..661903 | Replicon | chromosome |
Accession | NZ_CP098462 | ||
Organism | Neisseria gonorrhoeae strain 9460 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NC849_RS03510 | Protein ID | WP_003691083.1 |
Coordinates | 661484..661903 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NC849_RS03505 | Protein ID | WP_003688410.1 |
Coordinates | 661248..661484 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NC849_RS03475 (NC849_03460) | 656382..656669 | + | 288 | WP_003688407.1 | hypothetical protein | - |
NC849_RS03480 (NC849_03465) | 656741..657907 | + | 1167 | WP_003701280.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NC849_RS03485 (NC849_03470) | 657918..658808 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
NC849_RS03490 (NC849_03475) | 659191..659577 | - | 387 | Protein_682 | transposase | - |
NC849_RS03495 (NC849_03480) | 659816..660217 | + | 402 | WP_020997339.1 | helix-turn-helix domain-containing protein | - |
NC849_RS03500 (NC849_03485) | 660222..660800 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
NC849_RS03505 (NC849_03490) | 661248..661484 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NC849_RS03510 (NC849_03495) | 661484..661903 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NC849_RS03515 (NC849_03500) | 662052..663506 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NC849_RS03520 (NC849_03505) | 663503..664204 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
NC849_RS03525 (NC849_03510) | 664201..664980 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NC849_RS03530 (NC849_03515) | 665128..666669 | + | 1542 | WP_003701286.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247667 WP_003691083.1 NZ_CP098462:661484-661903 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|