Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1654136..1654821 | Replicon | chromosome |
| Accession | NZ_CP098460 | ||
| Organism | Neisseria gonorrhoeae strain 10814 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NC848_RS08600 | Protein ID | WP_003689143.1 |
| Coordinates | 1654639..1654821 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NC848_RS08595 | Protein ID | WP_003691454.1 |
| Coordinates | 1654136..1654537 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC848_RS08550 (NC848_08475) | 1649551..1649733 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NC848_RS08555 (NC848_08480) | 1649873..1650559 | - | 687 | WP_042758540.1 | hypothetical protein | - |
| NC848_RS08560 (NC848_08485) | 1650628..1650789 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| NC848_RS08565 (NC848_08490) | 1650786..1651064 | - | 279 | WP_041421244.1 | hypothetical protein | - |
| NC848_RS08570 (NC848_08495) | 1651217..1651549 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NC848_RS08575 (NC848_08500) | 1651690..1651854 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| NC848_RS08580 (NC848_08505) | 1652095..1652856 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NC848_RS08585 (NC848_08510) | 1652945..1653361 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| NC848_RS08590 (NC848_08515) | 1653370..1653954 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| NC848_RS08595 (NC848_08520) | 1654136..1654537 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NC848_RS08600 (NC848_08525) | 1654639..1654821 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NC848_RS08605 (NC848_08530) | 1654991..1655809 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NC848_RS08610 (NC848_08535) | 1656084..1656839 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NC848_RS08615 (NC848_08540) | 1656976..1657161 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NC848_RS08620 (NC848_08545) | 1657250..1657405 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| NC848_RS08625 (NC848_08550) | 1657382..1657570 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| NC848_RS08630 (NC848_08555) | 1657743..1657970 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| NC848_RS08635 (NC848_08560) | 1657967..1658479 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| NC848_RS08640 (NC848_08565) | 1658493..1659011 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| NC848_RS08645 (NC848_08570) | 1659026..1659805 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1637806..1672309 | 34503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247666 WP_003689143.1 NZ_CP098460:c1654821-1654639 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247666 WP_003691454.1 NZ_CP098460:c1654537-1654136 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|