Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 952124..952779 | Replicon | chromosome |
Accession | NZ_CP098460 | ||
Organism | Neisseria gonorrhoeae strain 10814 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NC848_RS04920 | Protein ID | WP_003691083.1 |
Coordinates | 952124..952543 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NC848_RS04925 | Protein ID | WP_003688410.1 |
Coordinates | 952543..952779 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NC848_RS04900 (NC848_04855) | 947358..948899 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
NC848_RS04905 (NC848_04860) | 949047..949826 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NC848_RS04910 (NC848_04865) | 949823..950524 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
NC848_RS04915 (NC848_04870) | 950521..951975 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NC848_RS04920 (NC848_04875) | 952124..952543 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NC848_RS04925 (NC848_04880) | 952543..952779 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NC848_RS04930 (NC848_04885) | 953226..953804 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
NC848_RS04935 (NC848_04890) | 953809..954099 | - | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
NC848_RS04940 (NC848_04895) | 954449..954835 | + | 387 | Protein_970 | transposase | - |
NC848_RS04945 (NC848_04900) | 955218..956108 | - | 891 | WP_229930257.1 | succinate--CoA ligase subunit alpha | - |
NC848_RS04950 (NC848_04905) | 956119..957285 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NC848_RS04955 (NC848_04910) | 957357..957644 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 954428..954901 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247665 WP_003691083.1 NZ_CP098460:c952543-952124 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|