Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1663086..1663771 | Replicon | chromosome |
| Accession | NZ_CP098458 | ||
| Organism | Neisseria gonorrhoeae strain 10588 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NC846_RS08660 | Protein ID | WP_003689143.1 |
| Coordinates | 1663589..1663771 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NC846_RS08655 | Protein ID | WP_003691454.1 |
| Coordinates | 1663086..1663487 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC846_RS08610 (NC846_08535) | 1658501..1658683 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NC846_RS08615 (NC846_08540) | 1658823..1659509 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| NC846_RS08620 (NC846_08545) | 1659578..1659739 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| NC846_RS08625 (NC846_08550) | 1659736..1660014 | - | 279 | WP_229930232.1 | hypothetical protein | - |
| NC846_RS08630 (NC846_08555) | 1660167..1660499 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NC846_RS08635 (NC846_08560) | 1660640..1660804 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| NC846_RS08640 (NC846_08565) | 1661045..1661806 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NC846_RS08645 (NC846_08570) | 1661895..1662311 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| NC846_RS08650 (NC846_08575) | 1662320..1662904 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| NC846_RS08655 (NC846_08580) | 1663086..1663487 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NC846_RS08660 (NC846_08585) | 1663589..1663771 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NC846_RS08665 (NC846_08590) | 1663941..1664759 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NC846_RS08670 (NC846_08595) | 1665034..1665789 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NC846_RS08675 (NC846_08600) | 1665926..1666111 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NC846_RS08680 (NC846_08605) | 1666200..1666355 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| NC846_RS08685 (NC846_08610) | 1666332..1666520 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| NC846_RS08690 (NC846_08615) | 1666693..1666920 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| NC846_RS08695 (NC846_08620) | 1666917..1667429 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| NC846_RS08700 (NC846_08625) | 1667443..1667961 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| NC846_RS08705 (NC846_08630) | 1667976..1668755 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1646755..1681242 | 34487 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247664 WP_003689143.1 NZ_CP098458:c1663771-1663589 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247664 WP_003691454.1 NZ_CP098458:c1663487-1663086 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|