Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 28829..29364 Replicon plasmid p1_FZP3115
Accession NZ_CP098451
Organism Proteus mirabilis strain FZP3115

Toxin (Protein)


Gene name relE Uniprot ID A0A218N496
Locus tag NBG99_RS19895 Protein ID WP_036896464.1
Coordinates 29077..29364 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A218N4B4
Locus tag NBG99_RS19890 Protein ID WP_036896461.1
Coordinates 28829..29080 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBG99_RS19865 (NBG99_19865) 26248..26535 - 288 WP_036896447.1 TrbC/VirB2 family protein -
NBG99_RS19870 (NBG99_19870) 26545..27159 - 615 WP_036896450.1 lytic transglycosylase domain-containing protein -
NBG99_RS19875 (NBG99_19875) 27156..27338 - 183 WP_036896454.1 hypothetical protein -
NBG99_RS19880 (NBG99_19880) 27494..27760 - 267 WP_142836830.1 hypothetical protein -
NBG99_RS19885 (NBG99_19885) 28015..28425 - 411 WP_036896458.1 replication/maintenance protein RepL -
NBG99_RS19890 (NBG99_19890) 28829..29080 + 252 WP_036896461.1 antitoxin Antitoxin
NBG99_RS19895 (NBG99_19895) 29077..29364 + 288 WP_036896464.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NBG99_RS19900 (NBG99_19900) 29455..30618 - 1164 WP_036896467.1 MobP1 family relaxase -
NBG99_RS19905 (NBG99_19905) 30627..31175 - 549 WP_036896470.1 DNA distortion polypeptide 1 -
NBG99_RS20230 31564..31698 - 135 WP_257792832.1 hypothetical protein -
NBG99_RS19910 (NBG99_19910) 31979..32311 - 333 WP_036896473.1 hypothetical protein -
NBG99_RS19915 (NBG99_19915) 32406..32603 - 198 WP_049195515.1 helix-turn-helix domain-containing protein -
NBG99_RS19920 (NBG99_19920) 32596..32826 - 231 WP_036896410.1 hypothetical protein -
NBG99_RS19925 (NBG99_19925) 32839..32997 - 159 WP_251101684.1 hypothetical protein -
NBG99_RS19930 (NBG99_19930) 33000..33557 - 558 WP_251101685.1 hypothetical protein -
NBG99_RS19935 (NBG99_19935) 33608..34123 - 516 WP_036896414.1 J domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..49422 49422


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11135.24 Da        Isoelectric Point: 10.6493

>T247660 WP_036896464.1 NZ_CP098451:29077-29364 [Proteus mirabilis]
MMYSVKFRKDAEKEWKKLDKTIQSQFAKQLIKRCENPHVASAKLRNMPNCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
REKSQVYNLASERLK

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9165.45 Da        Isoelectric Point: 4.0548

>AT247660 WP_036896461.1 NZ_CP098451:28829-29080 [Proteus mirabilis]
MPNTILSDTTASVSELKKNPMATVNAGLGYPVAILNRNQPAFYCVPAELYEQILDALDDNELAKLVKERESQPLVDINLA
EYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A218N496

Antitoxin

Source ID Structure
AlphaFold DB A0A218N4B4

References