Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3948733..3949534 | Replicon | chromosome |
| Accession | NZ_CP098450 | ||
| Organism | Proteus mirabilis strain FZP3115 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0E0XS49 |
| Locus tag | NBG99_RS18670 | Protein ID | WP_001094437.1 |
| Coordinates | 3948733..3949110 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0E0XTQ1 |
| Locus tag | NBG99_RS18675 | Protein ID | WP_001390338.1 |
| Coordinates | 3949157..3949534 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBG99_RS18640 (NBG99_18640) | 3944156..3944476 | - | 321 | WP_004246668.1 | helix-turn-helix transcriptional regulator | - |
| NBG99_RS18645 (NBG99_18645) | 3945247..3945399 | + | 153 | Protein_3626 | integrase core domain-containing protein | - |
| NBG99_RS18650 (NBG99_18650) | 3945524..3946558 | - | 1035 | WP_017628609.1 | RhuM family protein | - |
| NBG99_RS18655 (NBG99_18655) | 3947101..3947946 | - | 846 | WP_001274561.1 | DUF4942 domain-containing protein | - |
| NBG99_RS18660 (NBG99_18660) | 3948031..3948228 | - | 198 | WP_000772032.1 | DUF957 domain-containing protein | - |
| NBG99_RS18665 (NBG99_18665) | 3948248..3948736 | - | 489 | WP_000761716.1 | DUF5983 family protein | - |
| NBG99_RS18670 (NBG99_18670) | 3948733..3949110 | - | 378 | WP_001094437.1 | TA system toxin CbtA family protein | Toxin |
| NBG99_RS18675 (NBG99_18675) | 3949157..3949534 | - | 378 | WP_001390338.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBG99_RS18680 (NBG99_18680) | 3949697..3949918 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NBG99_RS18685 (NBG99_18685) | 3949981..3950457 | - | 477 | WP_001535682.1 | RadC family protein | - |
| NBG99_RS18690 (NBG99_18690) | 3950473..3950946 | - | 474 | WP_000855064.1 | antirestriction protein | - |
| NBG99_RS18695 (NBG99_18695) | 3951288..3952106 | - | 819 | WP_001535681.1 | DUF932 domain-containing protein | - |
| NBG99_RS18700 (NBG99_18700) | 3952224..3952419 | - | 196 | Protein_3637 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.90 Da Isoelectric Point: 7.3223
>T247658 WP_001094437.1 NZ_CP098450:c3949110-3948733 [Proteus mirabilis]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13745.44 Da Isoelectric Point: 5.0463
>AT247658 WP_001390338.1 NZ_CP098450:c3949534-3949157 [Proteus mirabilis]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XS49 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTQ1 |