Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-MqsA |
Location | 3785349..3786048 | Replicon | chromosome |
Accession | NZ_CP098450 | ||
Organism | Proteus mirabilis strain FZP3115 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NBG99_RS17915 | Protein ID | WP_017628658.1 |
Coordinates | 3785349..3785735 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B4EZ97 |
Locus tag | NBG99_RS17920 | Protein ID | WP_004246828.1 |
Coordinates | 3785728..3786048 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBG99_RS17900 (NBG99_17900) | 3781368..3781949 | - | 582 | WP_012368524.1 | DNA-3-methyladenine glycosylase I | - |
NBG99_RS17905 (NBG99_17905) | 3782200..3783105 | + | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
NBG99_RS17910 (NBG99_17910) | 3783115..3785187 | + | 2073 | WP_017628659.1 | glycine--tRNA ligase subunit beta | - |
NBG99_RS17915 (NBG99_17915) | 3785349..3785735 | + | 387 | WP_017628658.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBG99_RS17920 (NBG99_17920) | 3785728..3786048 | + | 321 | WP_004246828.1 | helix-turn-helix domain-containing protein | Antitoxin |
NBG99_RS17925 (NBG99_17925) | 3786097..3786531 | - | 435 | WP_004246827.1 | hypothetical protein | - |
NBG99_RS17930 (NBG99_17930) | 3786524..3787408 | - | 885 | WP_012368526.1 | endonuclease/exonuclease/phosphatase family protein | - |
NBG99_RS17935 (NBG99_17935) | 3787623..3788909 | - | 1287 | WP_063073863.1 | DUF3748 domain-containing protein | - |
NBG99_RS17940 (NBG99_17940) | 3789046..3789663 | + | 618 | WP_004246822.1 | trimeric intracellular cation channel family protein | - |
NBG99_RS17945 (NBG99_17945) | 3789964..3790587 | + | 624 | WP_004246821.1 | guanylate kinase | - |
NBG99_RS17950 (NBG99_17950) | 3790642..3790917 | + | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14322.65 Da Isoelectric Point: 10.0826
>T247657 WP_017628658.1 NZ_CP098450:3785349-3785735 [Proteus mirabilis]
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVRYD
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVRYD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|