Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1846515..1847314 | Replicon | chromosome |
Accession | NZ_CP098450 | ||
Organism | Proteus mirabilis strain FZP3115 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A8E3RD10 |
Locus tag | NBG99_RS08910 | Protein ID | WP_004247966.1 |
Coordinates | 1846790..1847314 (+) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | B4EVS2 |
Locus tag | NBG99_RS08905 | Protein ID | WP_004247964.1 |
Coordinates | 1846515..1846793 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBG99_RS08880 (NBG99_08880) | 1841865..1842947 | + | 1083 | WP_004242680.1 | peptide chain release factor 1 | - |
NBG99_RS08885 (NBG99_08885) | 1842947..1843795 | + | 849 | WP_004247962.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
NBG99_RS08890 (NBG99_08890) | 1843773..1844588 | + | 816 | WP_004242688.1 | invasion regulator SirB1 | - |
NBG99_RS08895 (NBG99_08895) | 1844646..1845500 | + | 855 | WP_004242689.1 | 3-deoxy-8-phosphooctulonate synthase | - |
NBG99_RS08900 (NBG99_08900) | 1845508..1846437 | + | 930 | WP_017628160.1 | TIGR01212 family radical SAM protein | - |
NBG99_RS08905 (NBG99_08905) | 1846515..1846793 | + | 279 | WP_004247964.1 | DUF1778 domain-containing protein | Antitoxin |
NBG99_RS08910 (NBG99_08910) | 1846790..1847314 | + | 525 | WP_004247966.1 | hypothetical protein | Toxin |
NBG99_RS08915 (NBG99_08915) | 1847395..1849095 | - | 1701 | WP_017628159.1 | C4-dicarboxylic acid transporter DauA | - |
NBG99_RS08925 (NBG99_08925) | 1850059..1851000 | + | 942 | WP_004242695.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19192.12 Da Isoelectric Point: 9.3561
>T247655 WP_004247966.1 NZ_CP098450:1846790-1847314 [Proteus mirabilis]
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|