Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 34823..35358 Replicon plasmid p1_FZP2936
Accession NZ_CP098448
Organism Proteus mirabilis strain FZP2936

Toxin (Protein)


Gene name relE Uniprot ID A0A218N496
Locus tag NBG97_RS19940 Protein ID WP_036896464.1
Coordinates 35071..35358 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A218N4B4
Locus tag NBG97_RS19935 Protein ID WP_036896461.1
Coordinates 34823..35074 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBG97_RS19910 (NBG97_19910) 32242..32529 - 288 WP_036896447.1 TrbC/VirB2 family protein -
NBG97_RS19915 (NBG97_19915) 32539..33153 - 615 WP_036896450.1 lytic transglycosylase domain-containing protein -
NBG97_RS19920 (NBG97_19920) 33150..33332 - 183 WP_036896454.1 hypothetical protein -
NBG97_RS19925 (NBG97_19925) 33488..33754 - 267 WP_142836830.1 hypothetical protein -
NBG97_RS19930 (NBG97_19930) 34009..34419 - 411 WP_036896458.1 replication/maintenance protein RepL -
NBG97_RS19935 (NBG97_19935) 34823..35074 + 252 WP_036896461.1 antitoxin Antitoxin
NBG97_RS19940 (NBG97_19940) 35071..35358 + 288 WP_036896464.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NBG97_RS19945 (NBG97_19945) 35449..36612 - 1164 WP_036896467.1 MobP1 family relaxase -
NBG97_RS19950 (NBG97_19950) 36621..37169 - 549 WP_036896470.1 DNA distortion polypeptide 1 -
NBG97_RS20230 37558..37692 - 135 WP_257792832.1 hypothetical protein -
NBG97_RS19955 (NBG97_19955) 37973..38305 - 333 WP_036896473.1 hypothetical protein -
NBG97_RS19960 (NBG97_19960) 38400..38597 - 198 WP_049195515.1 helix-turn-helix domain-containing protein -
NBG97_RS19965 (NBG97_19965) 38590..38820 - 231 WP_036896410.1 hypothetical protein -
NBG97_RS19970 (NBG97_19970) 38833..38991 - 159 WP_251101684.1 hypothetical protein -
NBG97_RS19975 (NBG97_19975) 38994..39551 - 558 WP_251101685.1 hypothetical protein -
NBG97_RS19980 (NBG97_19980) 39602..40117 - 516 WP_036896414.1 J domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..49422 49422


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11135.24 Da        Isoelectric Point: 10.6493

>T247652 WP_036896464.1 NZ_CP098448:35071-35358 [Proteus mirabilis]
MMYSVKFRKDAEKEWKKLDKTIQSQFAKQLIKRCENPHVASAKLRNMPNCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
REKSQVYNLASERLK

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9165.45 Da        Isoelectric Point: 4.0548

>AT247652 WP_036896461.1 NZ_CP098448:34823-35074 [Proteus mirabilis]
MPNTILSDTTASVSELKKNPMATVNAGLGYPVAILNRNQPAFYCVPAELYEQILDALDDNELAKLVKERESQPLVDINLA
EYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A218N496

Antitoxin

Source ID Structure
AlphaFold DB A0A218N4B4

References