Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 13291..13892 | Replicon | chromosome |
Accession | NZ_CP098447 | ||
Organism | Proteus mirabilis strain FZP2936 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A1Z1SQZ4 |
Locus tag | NBG97_RS00060 | Protein ID | WP_036895893.1 |
Coordinates | 13291..13674 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A1Z1SPN9 |
Locus tag | NBG97_RS00065 | Protein ID | WP_004246496.1 |
Coordinates | 13671..13892 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBG97_RS00035 (NBG97_00035) | 8355..9842 | - | 1488 | WP_087726303.1 | PLP-dependent aminotransferase family protein | - |
NBG97_RS00040 (NBG97_00040) | 9971..10429 | + | 459 | Protein_7 | GNAT family N-acetyltransferase | - |
NBG97_RS00045 (NBG97_00045) | 10525..11262 | - | 738 | WP_004249950.1 | tetratricopeptide repeat protein | - |
NBG97_RS00050 (NBG97_00050) | 11371..12270 | + | 900 | WP_017826985.1 | N-acetylmuramic acid 6-phosphate etherase | - |
NBG97_RS00055 (NBG97_00055) | 12570..12884 | - | 315 | WP_004246498.1 | helix-turn-helix transcriptional regulator | - |
NBG97_RS00060 (NBG97_00060) | 13291..13674 | - | 384 | WP_036895893.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NBG97_RS00065 (NBG97_00065) | 13671..13892 | - | 222 | WP_004246496.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NBG97_RS00070 (NBG97_00070) | 14173..15036 | - | 864 | WP_004249947.1 | YicC/YloC family endoribonuclease | - |
NBG97_RS00075 (NBG97_00075) | 15163..15879 | + | 717 | WP_004249760.1 | ribonuclease PH | - |
NBG97_RS00080 (NBG97_00080) | 15961..16605 | + | 645 | WP_004246493.1 | orotate phosphoribosyltransferase | - |
NBG97_RS00085 (NBG97_00085) | 16924..17529 | - | 606 | WP_004246491.1 | nucleoid occlusion factor SlmA | - |
NBG97_RS00090 (NBG97_00090) | 17649..18107 | - | 459 | WP_004246490.1 | dUTP diphosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14518.52 Da Isoelectric Point: 8.4945
>T247645 WP_036895893.1 NZ_CP098447:c13674-13291 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGRIFNDGNKRTAFFVT
MTFLYRNGIRIRDTDNTLENLTVEAATGEKTVDQLAKHLQNLVEKTN
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGRIFNDGNKRTAFFVT
MTFLYRNGIRIRDTDNTLENLTVEAATGEKTVDQLAKHLQNLVEKTN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Z1SQZ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Z1SPN9 |