Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-MqsA |
Location | 3721993..3722692 | Replicon | chromosome |
Accession | NZ_CP098446 | ||
Organism | Proteus mirabilis strain FZP2826 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B4EZ96 |
Locus tag | NBG95_RS17215 | Protein ID | WP_004249093.1 |
Coordinates | 3721993..3722379 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B4EZ97 |
Locus tag | NBG95_RS17220 | Protein ID | WP_004246828.1 |
Coordinates | 3722372..3722692 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBG95_RS17200 (NBG95_17200) | 3718012..3718593 | - | 582 | WP_012368524.1 | DNA-3-methyladenine glycosylase I | - |
NBG95_RS17205 (NBG95_17205) | 3718844..3719749 | + | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
NBG95_RS17210 (NBG95_17210) | 3719759..3721831 | + | 2073 | WP_017628659.1 | glycine--tRNA ligase subunit beta | - |
NBG95_RS17215 (NBG95_17215) | 3721993..3722379 | + | 387 | WP_004249093.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBG95_RS17220 (NBG95_17220) | 3722372..3722692 | + | 321 | WP_004246828.1 | helix-turn-helix domain-containing protein | Antitoxin |
NBG95_RS17225 (NBG95_17225) | 3722741..3723175 | - | 435 | WP_004246827.1 | hypothetical protein | - |
NBG95_RS17230 (NBG95_17230) | 3723168..3724052 | - | 885 | WP_004249091.1 | endonuclease/exonuclease/phosphatase family protein | - |
NBG95_RS17235 (NBG95_17235) | 3724267..3725553 | - | 1287 | WP_087741020.1 | DUF3748 domain-containing protein | - |
NBG95_RS17240 (NBG95_17240) | 3725690..3726307 | + | 618 | WP_004246822.1 | trimeric intracellular cation channel family protein | - |
NBG95_RS17245 (NBG95_17245) | 3726608..3727231 | + | 624 | WP_004246821.1 | guanylate kinase | - |
NBG95_RS17250 (NBG95_17250) | 3727286..3727561 | + | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14294.64 Da Isoelectric Point: 10.0642
>T247643 WP_004249093.1 NZ_CP098446:3721993-3722379 [Proteus mirabilis]
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|