Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1523123..1523768 | Replicon | chromosome |
| Accession | NZ_CP098446 | ||
| Organism | Proteus mirabilis strain FZP2826 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B4ET86 |
| Locus tag | NBG95_RS07140 | Protein ID | WP_004247035.1 |
| Coordinates | 1523583..1523768 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NBG95_RS07135 | Protein ID | WP_134736515.1 |
| Coordinates | 1523123..1523536 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBG95_RS07105 (NBG95_07105) | 1518676..1518834 | - | 159 | WP_004247025.1 | hypothetical protein | - |
| NBG95_RS07110 (NBG95_07110) | 1519286..1519462 | + | 177 | WP_004247793.1 | hypothetical protein | - |
| NBG95_RS07115 (NBG95_07115) | 1519633..1520379 | - | 747 | Protein_1369 | class I SAM-dependent methyltransferase | - |
| NBG95_RS07120 (NBG95_07120) | 1521229..1521807 | + | 579 | WP_161772320.1 | alpha/beta hydrolase | - |
| NBG95_RS07125 (NBG95_07125) | 1521920..1522162 | - | 243 | WP_228766819.1 | hypothetical protein | - |
| NBG95_RS07130 (NBG95_07130) | 1522527..1523027 | - | 501 | WP_004247032.1 | response regulator | - |
| NBG95_RS07135 (NBG95_07135) | 1523123..1523536 | - | 414 | WP_134736515.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NBG95_RS07140 (NBG95_07140) | 1523583..1523768 | - | 186 | WP_004247035.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NBG95_RS07145 (NBG95_07145) | 1523856..1524341 | + | 486 | WP_223307226.1 | DUF1073 domain-containing protein | - |
| NBG95_RS07150 (NBG95_07150) | 1524284..1524652 | + | 369 | WP_232091335.1 | DUF1073 domain-containing protein | - |
| NBG95_RS07155 (NBG95_07155) | 1524655..1524873 | + | 219 | Protein_1377 | hypothetical protein | - |
| NBG95_RS07160 (NBG95_07160) | 1524943..1525095 | + | 153 | WP_196537697.1 | hypothetical protein | - |
| NBG95_RS07165 (NBG95_07165) | 1525208..1525759 | - | 552 | WP_017628396.1 | PH domain-containing protein | - |
| NBG95_RS07170 (NBG95_07170) | 1525823..1526137 | - | 315 | WP_017628395.1 | hypothetical protein | - |
| NBG95_RS07180 (NBG95_07180) | 1526544..1528277 | - | 1734 | WP_017628394.1 | LPS biosynthesis-modulating metalloenzyme YejM | - |
| NBG95_RS07185 (NBG95_07185) | 1528301..1528528 | - | 228 | WP_004247042.1 | YejL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1513234..1535750 | 22516 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7049.30 Da Isoelectric Point: 10.9659
>T247640 WP_004247035.1 NZ_CP098446:c1523768-1523583 [Proteus mirabilis]
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15250.99 Da Isoelectric Point: 4.4531
>AT247640 WP_134736515.1 NZ_CP098446:c1523536-1523123 [Proteus mirabilis]
MLYPAFIEIDENGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
MLYPAFIEIDENGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|