Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 98008..98533 | Replicon | plasmid unnamed1 |
Accession | NZ_CP098439 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | M9193_RS23660 | Protein ID | WP_001159868.1 |
Coordinates | 98228..98533 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | M9193_RS23655 | Protein ID | WP_000813634.1 |
Coordinates | 98008..98226 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9193_RS23625 (93401) | 93401..93817 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
M9193_RS23630 (93814) | 93814..94044 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M9193_RS23635 (94309) | 94309..94809 | + | 501 | WP_000528931.1 | HEPN family nuclease | - |
M9193_RS23640 (94822) | 94822..95595 | + | 774 | WP_000905949.1 | hypothetical protein | - |
M9193_RS23645 (95762) | 95762..96895 | + | 1134 | WP_000545987.1 | DUF3800 domain-containing protein | - |
M9193_RS23650 (96929) | 96929..97417 | - | 489 | WP_011254646.1 | hypothetical protein | - |
M9193_RS23655 (98008) | 98008..98226 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M9193_RS23660 (98228) | 98228..98533 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M9193_RS23665 (98534) | 98534..99340 | + | 807 | WP_000016982.1 | site-specific integrase | - |
M9193_RS23670 (100114) | 100114..100869 | + | 756 | WP_000852145.1 | replication initiation protein RepE | - |
M9193_RS23675 (101457) | 101457..102623 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..109442 | 109442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T247639 WP_001159868.1 NZ_CP098439:98228-98533 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|