247638

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 93401..94044 Replicon plasmid unnamed1
Accession NZ_CP098439
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag M9193_RS23625 Protein ID WP_001034046.1
Coordinates 93401..93817 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag M9193_RS23630 Protein ID WP_001261278.1
Coordinates 93814..94044 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9193_RS23610 (88538) 88538..88954 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
M9193_RS23615 (88951) 88951..89181 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
M9193_RS23620 (89562) 89562..93356 + 3795 WP_001144732.1 hypothetical protein -
M9193_RS23625 (93401) 93401..93817 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
M9193_RS23630 (93814) 93814..94044 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M9193_RS23635 (94309) 94309..94809 + 501 WP_000528931.1 HEPN family nuclease -
M9193_RS23640 (94822) 94822..95595 + 774 WP_000905949.1 hypothetical protein -
M9193_RS23645 (95762) 95762..96895 + 1134 WP_000545987.1 DUF3800 domain-containing protein -
M9193_RS23650 (96929) 96929..97417 - 489 WP_011254646.1 hypothetical protein -
M9193_RS23655 (98008) 98008..98226 + 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
M9193_RS23660 (98228) 98228..98533 + 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / sitABCD iucA / iucB / iucC / iucD / iutA 1..109442 109442


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T247638 WP_001034046.1 NZ_CP098439:c93817-93401 [Salmonella enterica subsp. enterica serovar Typhimurium]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT247638 WP_001261278.1 NZ_CP098439:c94044-93814 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References