Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 88538..89181 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP098439 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | M9193_RS23610 | Protein ID | WP_001034044.1 |
| Coordinates | 88538..88954 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | M9193_RS23615 | Protein ID | WP_001261286.1 |
| Coordinates | 88951..89181 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9193_RS23595 (84940) | 84940..85637 | + | 698 | WP_223155668.1 | IS1-like element IS1A family transposase | - |
| M9193_RS23600 (85891) | 85891..86913 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
| M9193_RS23605 (86898) | 86898..88463 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
| M9193_RS23610 (88538) | 88538..88954 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M9193_RS23615 (88951) | 88951..89181 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M9193_RS23620 (89562) | 89562..93356 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
| M9193_RS23625 (93401) | 93401..93817 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| M9193_RS23630 (93814) | 93814..94044 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..109442 | 109442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T247637 WP_001034044.1 NZ_CP098439:c88954-88538 [Salmonella enterica subsp. enterica serovar Typhimurium]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |