Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 88538..89181 Replicon plasmid unnamed1
Accession NZ_CP098439
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag M9193_RS23610 Protein ID WP_001034044.1
Coordinates 88538..88954 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag M9193_RS23615 Protein ID WP_001261286.1
Coordinates 88951..89181 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9193_RS23595 (84940) 84940..85637 + 698 WP_223155668.1 IS1-like element IS1A family transposase -
M9193_RS23600 (85891) 85891..86913 - 1023 WP_000361402.1 helicase UvrD -
M9193_RS23605 (86898) 86898..88463 - 1566 WP_001128474.1 AAA family ATPase -
M9193_RS23610 (88538) 88538..88954 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
M9193_RS23615 (88951) 88951..89181 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M9193_RS23620 (89562) 89562..93356 + 3795 WP_001144732.1 hypothetical protein -
M9193_RS23625 (93401) 93401..93817 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
M9193_RS23630 (93814) 93814..94044 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / sitABCD iucA / iucB / iucC / iucD / iutA 1..109442 109442


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T247637 WP_001034044.1 NZ_CP098439:c88954-88538 [Salmonella enterica subsp. enterica serovar Typhimurium]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT247637 WP_001261286.1 NZ_CP098439:c89181-88951 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References