Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4176322..4176838 | Replicon | chromosome |
Accession | NZ_CP098438 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | M9193_RS20185 | Protein ID | WP_000220578.1 |
Coordinates | 4176322..4176606 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | M9193_RS20190 | Protein ID | WP_000212724.1 |
Coordinates | 4176596..4176838 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9193_RS20170 (4171534) | 4171534..4173186 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
M9193_RS20175 (4173595) | 4173595..4175733 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M9193_RS20180 (4175854) | 4175854..4176318 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M9193_RS20185 (4176322) | 4176322..4176606 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9193_RS20190 (4176596) | 4176596..4176838 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M9193_RS20195 (4176916) | 4176916..4178829 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
M9193_RS20200 (4178846) | 4178846..4179586 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
M9193_RS20205 (4179583) | 4179583..4180701 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
M9193_RS20210 (4180685) | 4180685..4181818 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T247631 WP_000220578.1 NZ_CP098438:c4176606-4176322 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |