Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3482100..3482720 | Replicon | chromosome |
Accession | NZ_CP098438 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | M9193_RS17030 | Protein ID | WP_001280991.1 |
Coordinates | 3482502..3482720 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | M9193_RS17025 | Protein ID | WP_000344807.1 |
Coordinates | 3482100..3482474 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9193_RS17015 (3477239) | 3477239..3478432 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M9193_RS17020 (3478455) | 3478455..3481604 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
M9193_RS17025 (3482100) | 3482100..3482474 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
M9193_RS17030 (3482502) | 3482502..3482720 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
M9193_RS17035 (3482899) | 3482899..3483450 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
M9193_RS17040 (3483567) | 3483567..3484037 | + | 471 | WP_000136181.1 | YlaC family protein | - |
M9193_RS17045 (3484093) | 3484093..3484233 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
M9193_RS17050 (3484239) | 3484239..3484499 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
M9193_RS17055 (3484724) | 3484724..3486274 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
M9193_RS17065 (3486505) | 3486505..3486894 | + | 390 | WP_000961285.1 | MGMT family protein | - |
M9193_RS17070 (3486927) | 3486927..3487496 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T247627 WP_001280991.1 NZ_CP098438:3482502-3482720 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT247627 WP_000344807.1 NZ_CP098438:3482100-3482474 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|