Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 880100..880760 | Replicon | chromosome |
Accession | NZ_CP098438 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | M9193_RS04230 | Protein ID | WP_000244756.1 |
Coordinates | 880347..880760 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | M9193_RS04225 | Protein ID | WP_000351186.1 |
Coordinates | 880100..880366 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9193_RS04205 (876028) | 876028..877461 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
M9193_RS04210 (877620) | 877620..877931 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
M9193_RS04215 (878095) | 878095..878754 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
M9193_RS04220 (878870) | 878870..879850 | - | 981 | WP_000874172.1 | tRNA-modifying protein YgfZ | - |
M9193_RS04225 (880100) | 880100..880366 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
M9193_RS04230 (880347) | 880347..880760 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
M9193_RS04235 (880813) | 880813..881334 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
M9193_RS04240 (881447) | 881447..882343 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
M9193_RS04245 (882367) | 882367..883080 | + | 714 | WP_000745625.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M9193_RS04250 (883086) | 883086..884819 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T247619 WP_000244756.1 NZ_CP098438:880347-880760 [Salmonella enterica subsp. enterica serovar Typhimurium]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT247619 WP_000351186.1 NZ_CP098438:880100-880366 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |