Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 38771..39908 | Replicon | plasmid pCQ025-3 |
Accession | NZ_CP098421 | ||
Organism | Enterococcus faecalis strain CQ025 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | NAG09_RS14965 | Protein ID | WP_250170996.1 |
Coordinates | 38771..39634 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | B3CKC7 |
Locus tag | NAG09_RS14970 | Protein ID | WP_002333002.1 |
Coordinates | 39636..39908 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG09_RS14940 (34226) | 34226..34570 | + | 345 | Protein_38 | IS30 family transposase | - |
NAG09_RS14945 (34642) | 34642..36255 | - | 1614 | WP_002333004.1 | hypothetical protein | - |
NAG09_RS14950 (36279) | 36279..37160 | - | 882 | WP_002326774.1 | ABC transporter ATP-binding protein | - |
NAG09_RS14955 (37471) | 37471..38067 | + | 597 | WP_085442989.1 | TetR/AcrR family transcriptional regulator | - |
NAG09_RS14960 (38236) | 38236..38640 | - | 405 | Protein_42 | DnaJ domain-containing protein | - |
NAG09_RS14965 (38771) | 38771..39634 | - | 864 | WP_250170996.1 | zeta toxin family protein | Toxin |
NAG09_RS14970 (39636) | 39636..39908 | - | 273 | WP_002333002.1 | antitoxin | Antitoxin |
NAG09_RS14975 (39926) | 39926..40141 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
NAG09_RS14980 (40233) | 40233..41129 | - | 897 | WP_104681373.1 | ParA family protein | - |
NAG09_RS14985 (41232) | 41232..43064 | - | 1833 | WP_250652965.1 | type IA DNA topoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrG / aph(3')-III / erm(B) | - | 1..59669 | 59669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32365.76 Da Isoelectric Point: 6.3643
>T247614 WP_250170996.1 NZ_CP098421:c39634-38771 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|