Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 13974..14545 Replicon plasmid pCQ025-3
Accession NZ_CP098421
Organism Enterococcus faecalis strain CQ025

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag NAG09_RS14820 Protein ID WP_002362432.1
Coordinates 13974..14315 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag NAG09_RS14825 Protein ID WP_002362431.1
Coordinates 14315..14545 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NAG09_RS14800 (10887) 10887..11282 - 396 WP_002383639.1 hypothetical protein -
NAG09_RS14805 (11239) 11239..12561 - 1323 Protein_11 ATP-binding protein -
NAG09_RS14810 (12637) 12637..13317 + 681 WP_174087370.1 IS6-like element IS1216 family transposase -
NAG09_RS14815 (13347) 13347..13802 - 456 WP_251108137.1 hypothetical protein -
NAG09_RS14820 (13974) 13974..14315 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NAG09_RS14825 (14315) 14315..14545 - 231 WP_002362431.1 hypothetical protein Antitoxin
NAG09_RS14830 (14749) 14749..15369 + 621 WP_161971471.1 recombinase family protein -
NAG09_RS14835 (15386) 15386..15550 + 165 WP_250652966.1 hypothetical protein -
NAG09_RS14845 (16954) 16954..17187 + 234 WP_002394799.1 hypothetical protein -
NAG09_RS14850 (17347) 17347..17601 - 255 WP_002394800.1 hypothetical protein -
NAG09_RS14855 (17718) 17718..18386 - 669 WP_002403283.1 CPBP family intramembrane metalloprotease -
NAG09_RS14860 (18422) 18422..18739 - 318 WP_002394802.1 heavy metal-binding domain-containing protein -
NAG09_RS14865 (19234) 19234..19344 + 111 WP_002360667.1 type I toxin-antitoxin system Fst family toxin -
- (19384) 19384..19475 - 92 NuclAT_0 - -
- (19384) 19384..19475 - 92 NuclAT_0 - -
- (19384) 19384..19475 - 92 NuclAT_0 - -
- (19384) 19384..19475 - 92 NuclAT_0 - -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrG / aph(3')-III / erm(B) - 1..59669 59669
- flank IS/Tn - - 12631..13317 686


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T247609 WP_002362432.1 NZ_CP098421:c14315-13974 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT247609 WP_002362431.1 NZ_CP098421:c14545-14315 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References