Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1348539..1349455 | Replicon | chromosome |
Accession | NZ_CP098417 | ||
Organism | Bacillus subtilis strain N2-10 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NCL52_RS07045 | Protein ID | WP_003244695.1 |
Coordinates | 1348709..1349455 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NCL52_RS07040 | Protein ID | WP_003232646.1 |
Coordinates | 1348539..1348709 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCL52_RS07005 (NCL52_07005) | 1345402..1345731 | + | 330 | WP_072176027.1 | XkdW family protein | - |
NCL52_RS07010 (NCL52_07010) | 1345728..1345892 | + | 165 | WP_014479563.1 | XkdX family protein | - |
NCL52_RS07015 (NCL52_07015) | 1345936..1346775 | + | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
NCL52_RS07020 (NCL52_07020) | 1346828..1347097 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
NCL52_RS07025 (NCL52_07025) | 1347110..1347373 | + | 264 | WP_003232653.1 | phage holin | - |
NCL52_RS07030 (NCL52_07030) | 1347386..1348279 | + | 894 | WP_122894620.1 | N-acetylmuramoyl-L-alanine amidase | - |
NCL52_RS07035 (NCL52_07035) | 1348316..1348453 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NCL52_RS07040 (NCL52_07040) | 1348539..1348709 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NCL52_RS07045 (NCL52_07045) | 1348709..1349455 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NCL52_RS07050 (NCL52_07050) | 1349565..1350566 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
NCL52_RS07055 (NCL52_07055) | 1350579..1351196 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NCL52_RS07060 (NCL52_07060) | 1351472..1352788 | - | 1317 | WP_085186195.1 | serine/threonine exchanger | - |
NCL52_RS07065 (NCL52_07065) | 1353176..1354126 | + | 951 | WP_124059769.1 | ring-cleaving dioxygenase | - |
NCL52_RS07070 (NCL52_07070) | 1354227..1354373 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T247590 WP_003244695.1 NZ_CP098417:c1349455-1348709 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|