Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 518757..519393 | Replicon | chromosome |
Accession | NZ_CP098417 | ||
Organism | Bacillus subtilis strain N2-10 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NCL52_RS02660 | Protein ID | WP_003156187.1 |
Coordinates | 519043..519393 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NCL52_RS02655 | Protein ID | WP_003225183.1 |
Coordinates | 518757..519038 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCL52_RS02635 (NCL52_02635) | 515116..515715 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
NCL52_RS02640 (NCL52_02640) | 515810..516175 | + | 366 | WP_014475874.1 | holo-ACP synthase | - |
NCL52_RS02645 (NCL52_02645) | 516341..517357 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
NCL52_RS02650 (NCL52_02650) | 517472..518641 | + | 1170 | WP_017697002.1 | alanine racemase | - |
NCL52_RS02655 (NCL52_02655) | 518757..519038 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NCL52_RS02660 (NCL52_02660) | 519043..519393 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NCL52_RS02665 (NCL52_02665) | 519508..520332 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
NCL52_RS02670 (NCL52_02670) | 520337..520702 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NCL52_RS02675 (NCL52_02675) | 520706..521107 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
NCL52_RS02680 (NCL52_02680) | 521119..522126 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
NCL52_RS02685 (NCL52_02685) | 522188..522517 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
NCL52_RS02690 (NCL52_02690) | 522514..522996 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
NCL52_RS02695 (NCL52_02695) | 522962..523750 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
NCL52_RS02700 (NCL52_02700) | 523750..524349 | + | 600 | WP_003234303.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T247589 WP_003156187.1 NZ_CP098417:519043-519393 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|