Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 2704026..2704677 | Replicon | chromosome |
| Accession | NZ_CP098411 | ||
| Organism | Lacticaseibacillus paracasei strain 401 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | K6S8L5 |
| Locus tag | NCY29_RS13030 | Protein ID | WP_003567661.1 |
| Coordinates | 2704026..2704409 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | K6RKI5 |
| Locus tag | NCY29_RS13035 | Protein ID | WP_003567665.1 |
| Coordinates | 2704429..2704677 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NCY29_RS13025 (NCY29_13025) | 2703321..2703842 | - | 522 | WP_063558320.1 | QueT transporter family protein | - |
| NCY29_RS13030 (NCY29_13030) | 2704026..2704409 | - | 384 | WP_003567661.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NCY29_RS13035 (NCY29_13035) | 2704429..2704677 | - | 249 | WP_003567665.1 | antitoxin | Antitoxin |
| NCY29_RS13040 (NCY29_13040) | 2704745..2705881 | - | 1137 | WP_016369534.1 | alanine racemase | - |
| NCY29_RS13045 (NCY29_13045) | 2705868..2706242 | - | 375 | WP_003567669.1 | holo-ACP synthase | - |
| NCY29_RS13050 (NCY29_13050) | 2706412..2707920 | - | 1509 | WP_003567670.1 | DEAD/DEAH box helicase | - |
| NCY29_RS13055 (NCY29_13055) | 2708046..2708189 | - | 144 | WP_003588978.1 | hypothetical protein | - |
| NCY29_RS13060 (NCY29_13060) | 2708220..2709608 | - | 1389 | WP_063558321.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13773.03 Da Isoelectric Point: 10.9764
>T247588 WP_003567661.1 NZ_CP098411:c2704409-2704026 [Lacticaseibacillus paracasei]
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K6S8L5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2BNY2 |