Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-HTH_37 |
| Location | 482230..482858 | Replicon | chromosome |
| Accession | NZ_CP098411 | ||
| Organism | Lacticaseibacillus paracasei strain 401 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NCY29_RS02190 | Protein ID | WP_003583266.1 |
| Coordinates | 482490..482858 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | NCY29_RS02185 | Protein ID | WP_003583264.1 |
| Coordinates | 482230..482490 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NCY29_RS02155 (NCY29_02155) | 478019..478549 | + | 531 | WP_012490988.1 | DNA-directed RNA polymerase subunit sigma-24 | - |
| NCY29_RS02160 (NCY29_02160) | 478717..478869 | + | 153 | WP_003563363.1 | YvrJ family protein | - |
| NCY29_RS02165 (NCY29_02165) | 478879..479643 | + | 765 | WP_250786050.1 | GH25 family lysozyme | - |
| NCY29_RS02170 (NCY29_02170) | 479854..480357 | + | 504 | WP_063557854.1 | TetR/AcrR family transcriptional regulator | - |
| NCY29_RS02175 (NCY29_02175) | 480362..481423 | + | 1062 | WP_016373561.1 | ABC transporter permease | - |
| NCY29_RS02180 (NCY29_02180) | 481428..482117 | + | 690 | WP_003583263.1 | ABC transporter ATP-binding protein | - |
| NCY29_RS02185 (NCY29_02185) | 482230..482490 | - | 261 | WP_003583264.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NCY29_RS02190 (NCY29_02190) | 482490..482858 | - | 369 | WP_003583266.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NCY29_RS02195 (NCY29_02195) | 483149..484519 | - | 1371 | WP_003573580.1 | FAD-dependent oxidoreductase | - |
| NCY29_RS02200 (NCY29_02200) | 484883..485701 | - | 819 | WP_011674103.1 | Cof-type HAD-IIB family hydrolase | - |
| NCY29_RS02205 (NCY29_02205) | 486012..486281 | - | 270 | WP_003563382.1 | type II toxin-antitoxin system YafQ family toxin | - |
| NCY29_RS02210 (NCY29_02210) | 486522..487529 | + | 1008 | WP_003563383.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 14939.01 Da Isoelectric Point: 8.3986
>T247586 WP_003583266.1 NZ_CP098411:c482858-482490 [Lacticaseibacillus paracasei]
MYKIDFYEDRDGYSEIEDFLDQLRHSHQKNNVSLLNKITKELYMLQNLGPRLREPHAKFLKGYAYPIMELRPMPERIFYA
AWQKDHFVLLHHYTKKTNKTDHREILRAQSNLEDWLSRKEEN
MYKIDFYEDRDGYSEIEDFLDQLRHSHQKNNVSLLNKITKELYMLQNLGPRLREPHAKFLKGYAYPIMELRPMPERIFYA
AWQKDHFVLLHHYTKKTNKTDHREILRAQSNLEDWLSRKEEN
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|