Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 1646378..1646888 Replicon chromosome
Accession NZ_CP098408
Organism Alcaligenes sp. DN25

Toxin (Protein)


Gene name relB Uniprot ID U1YHF7
Locus tag NBV64_RS07590 Protein ID WP_009459444.1
Coordinates 1646378..1646641 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID U1Y0D2
Locus tag NBV64_RS07595 Protein ID WP_009459443.1
Coordinates 1646634..1646888 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBV64_RS07550 (NBV64_07550) 1641602..1641946 - 345 WP_009459464.1 SMR family transporter -
NBV64_RS07555 (NBV64_07555) 1641953..1642471 - 519 WP_026484694.1 DedA family protein -
NBV64_RS07560 (NBV64_07560) 1642509..1642979 - 471 WP_250757004.1 GNAT family N-acetyltransferase -
NBV64_RS07565 (NBV64_07565) 1642976..1643377 - 402 WP_009459461.1 YchJ family metal-binding protein -
NBV64_RS07570 (NBV64_07570) 1643714..1644472 - 759 WP_009459460.1 M48 family metallopeptidase -
NBV64_RS07575 (NBV64_07575) 1644610..1644846 + 237 WP_250757005.1 hypothetical protein -
NBV64_RS07580 (NBV64_07580) 1644869..1645216 - 348 Protein_1480 MFS transporter -
NBV64_RS19075 1645235..1645360 - 126 WP_009459451.1 major facilitator superfamily transporter -
NBV64_RS07590 (NBV64_07590) 1646378..1646641 - 264 WP_009459444.1 Txe/YoeB family addiction module toxin Toxin
NBV64_RS07595 (NBV64_07595) 1646634..1646888 - 255 WP_009459443.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NBV64_RS07600 (NBV64_07600) 1647078..1647344 + 267 WP_035275328.1 hypothetical protein -
NBV64_RS07605 (NBV64_07605) 1647381..1648070 - 690 WP_088453217.1 S24 family peptidase -
NBV64_RS07610 (NBV64_07610) 1648024..1648545 - 522 WP_250757007.1 hypothetical protein -
NBV64_RS07615 (NBV64_07615) 1648607..1649392 + 786 WP_250757008.1 hypothetical protein -
NBV64_RS07620 (NBV64_07620) 1649376..1650083 + 708 WP_009459907.1 replication protein P -
NBV64_RS07625 (NBV64_07625) 1650091..1650414 + 324 WP_250757009.1 hypothetical protein -
NBV64_RS07630 (NBV64_07630) 1650428..1650808 + 381 WP_021446766.1 hypothetical protein -
NBV64_RS07635 (NBV64_07635) 1650805..1651053 + 249 WP_009459904.1 hypothetical protein -
NBV64_RS07640 (NBV64_07640) 1651228..1651647 + 420 WP_009459902.1 phage tail terminator-like protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10382.88 Da        Isoelectric Point: 9.0343

>T247585 WP_009459444.1 NZ_CP098408:c1646641-1646378 [Alcaligenes sp. DN25]
MTDRLLCWTDAAWIDYVYWQGQDRKTLKRINRLIEEVRRAPFDGIGKPEALKENLSGFWSRRIDDTNRLVYAVDKASITI
ISCRYHY

Download         Length: 264 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9416.59 Da        Isoelectric Point: 4.7778

>AT247585 WP_009459443.1 NZ_CP098408:c1646888-1646634 [Alcaligenes sp. DN25]
MKIISFSEARNSLKAVLDSVVDDASTTIITRRDAEDAVVMSLDYYNSLMETVHLLRSPANAEHLSRSIEQYRAGKAMPRE
LSDD

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U1YHF7

Antitoxin

Source ID Structure
AlphaFold DB U1Y0D2

References