Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Txe-Axe/YoeB-RelB |
| Location | 1549074..1549608 | Replicon | chromosome |
| Accession | NZ_CP098403 | ||
| Organism | Lactobacillus kefiranofaciens subsp. kefirgranum strain HL1 | ||
Toxin (Protein)
| Gene name | Txe | Uniprot ID | - |
| Locus tag | MU859_RS07825 | Protein ID | WP_013854792.1 |
| Coordinates | 1549345..1549608 (+) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | Axe | Uniprot ID | A0A656YAM3 |
| Locus tag | MU859_RS07820 | Protein ID | WP_013854791.1 |
| Coordinates | 1549074..1549361 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MU859_RS07795 (MU859_07795) | 1545730..1545963 | - | 234 | WP_025084256.1 | bacteriocin immunity protein | - |
| MU859_RS07800 (MU859_07800) | 1545938..1546135 | - | 198 | WP_013854786.1 | helix-turn-helix transcriptional regulator | - |
| MU859_RS07805 (MU859_07805) | 1546132..1546608 | - | 477 | WP_013854787.1 | hypothetical protein | - |
| MU859_RS07810 (MU859_07810) | 1547305..1548405 | + | 1101 | WP_250825310.1 | vitamin B12 independent methionine synthase | - |
| MU859_RS07815 (MU859_07815) | 1548468..1548944 | + | 477 | WP_095342457.1 | S-ribosylhomocysteine lyase | - |
| MU859_RS07820 (MU859_07820) | 1549074..1549361 | + | 288 | WP_013854791.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MU859_RS07825 (MU859_07825) | 1549345..1549608 | + | 264 | WP_013854792.1 | Txe/YoeB family addiction module toxin | Toxin |
| MU859_RS07830 (MU859_07830) | 1549892..1551217 | - | 1326 | WP_013851263.1 | RNA-guided endonuclease TnpB family protein | - |
| MU859_RS07835 (MU859_07835) | 1551247..1551855 | - | 609 | WP_250825305.1 | IS607 family transposase | - |
| MU859_RS07840 (MU859_07840) | 1551963..1552415 | - | 453 | WP_250825311.1 | hypothetical protein | - |
| MU859_RS07845 (MU859_07845) | 1552556..1552717 | - | 162 | WP_013854794.1 | hypothetical protein | - |
| MU859_RS07850 (MU859_07850) | 1552891..1554405 | - | 1515 | WP_250825312.1 | L-lactate permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10486.95 Da Isoelectric Point: 9.3821
>T247583 WP_013854792.1 NZ_CP098403:1549345-1549608 [Lactobacillus kefiranofaciens subsp. kefirgranum]
MLSWTDDGCDDYLNWQKQRQKKKIKRINKLITDIKRHPFEGMGKPEGLKNNLTGLWSRKIDAKNRIIYEYTNENVIIYSC
KDHYDDH
MLSWTDDGCDDYLNWQKQRQKKKIKRINKLITDIKRHPFEGMGKPEGLKNNLTGLWSRKIDAKNRIIYEYTNENVIIYSC
KDHYDDH
Download Length: 264 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10874.12 Da Isoelectric Point: 4.5296
>AT247583 WP_013854791.1 NZ_CP098403:1549074-1549361 [Lactobacillus kefiranofaciens subsp. kefirgranum]
MDAVNYSNFRKDLKTYFKQVNDDSEPLIVTNKNPEDNVVVLSKDEYDALIETLAIQSNKYLMDKINRGRKQVAKAQTNQH
ELIDPDGEVSDAKLD
MDAVNYSNFRKDLKTYFKQVNDDSEPLIVTNKNPEDNVVVLSKDEYDALIETLAIQSNKYLMDKINRGRKQVAKAQTNQH
ELIDPDGEVSDAKLD
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|