Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 1430314..1430902 | Replicon | chromosome |
Accession | NZ_CP098400 | ||
Organism | Alkaliflexus sp. Ai-910 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | M9189_RS06000 | Protein ID | WP_250725391.1 |
Coordinates | 1430314..1430613 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M9189_RS06005 | Protein ID | WP_250725393.1 |
Coordinates | 1430618..1430902 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9189_RS05980 (M9189_05980) | 1427028..1428191 | - | 1164 | WP_250723552.1 | IS4 family transposase | - |
M9189_RS05985 (M9189_05985) | 1428454..1428807 | + | 354 | WP_088656172.1 | hypothetical protein | - |
M9189_RS05990 (M9189_05990) | 1428800..1429855 | + | 1056 | WP_250723317.1 | transposase | - |
M9189_RS05995 (M9189_05995) | 1429900..1430049 | + | 150 | WP_250725390.1 | hypothetical protein | - |
M9189_RS06000 (M9189_06000) | 1430314..1430613 | + | 300 | WP_250725391.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9189_RS06005 (M9189_06005) | 1430618..1430902 | + | 285 | WP_250725393.1 | putative addiction module antidote protein | Antitoxin |
M9189_RS06010 (M9189_06010) | 1431205..1432005 | - | 801 | WP_250725395.1 | transposase | - |
M9189_RS06015 (M9189_06015) | 1432099..1433013 | - | 915 | WP_250725397.1 | tyrosine-type recombinase/integrase | - |
M9189_RS06020 (M9189_06020) | 1433255..1433764 | + | 510 | WP_250725398.1 | hypothetical protein | - |
M9189_RS06025 (M9189_06025) | 1434216..1434590 | + | 375 | WP_250725400.1 | hypothetical protein | - |
M9189_RS06030 (M9189_06030) | 1434593..1434958 | + | 366 | WP_062129131.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1430314..1453852 | 23538 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11757.88 Da Isoelectric Point: 10.2794
>T247581 WP_250725391.1 NZ_CP098400:1430314-1430613 [Alkaliflexus sp. Ai-910]
MYIIEKTEEFDKWLRKLKDLRAKAKILFRIQKIENDEHFGDCKLVGNGIRELKIDFAKGYRVYFKESDGKIIILLIGGDK
STQQRDIEKAKEILKRIKK
MYIIEKTEEFDKWLRKLKDLRAKAKILFRIQKIENDEHFGDCKLVGNGIRELKIDFAKGYRVYFKESDGKIIILLIGGDK
STQQRDIEKAKEILKRIKK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|