Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4159282..4159901 Replicon chromosome
Accession NZ_CP098355
Organism Klebsiella pneumoniae strain 13001

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NB672_RS20880 Protein ID WP_002892050.1
Coordinates 4159683..4159901 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NB672_RS20875 Protein ID WP_002892066.1
Coordinates 4159282..4159656 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB672_RS20865 (NB672_20865) 4154434..4155627 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NB672_RS20870 (NB672_20870) 4155650..4158796 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NB672_RS20875 (NB672_20875) 4159282..4159656 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NB672_RS20880 (NB672_20880) 4159683..4159901 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NB672_RS20885 (NB672_20885) 4160060..4160626 + 567 WP_002892030.1 maltose O-acetyltransferase -
NB672_RS20890 (NB672_20890) 4160598..4160738 - 141 WP_004147370.1 hypothetical protein -
NB672_RS20895 (NB672_20895) 4160759..4161229 + 471 WP_002892026.1 YlaC family protein -
NB672_RS20900 (NB672_20900) 4161204..4162655 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NB672_RS20905 (NB672_20905) 4162756..4163454 + 699 WP_002892021.1 GNAT family protein -
NB672_RS20910 (NB672_20910) 4163451..4163591 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NB672_RS20915 (NB672_20915) 4163591..4163854 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T247574 WP_002892050.1 NZ_CP098355:4159683-4159901 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT247574 WP_002892066.1 NZ_CP098355:4159282-4159656 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References