Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 160299..160824 | Replicon | plasmid p52977-166.3 |
| Accession | NZ_CP098354 | ||
| Organism | Klebsiella pneumoniae strain 52977_A1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | NB671_RS28860 | Protein ID | WP_001159868.1 |
| Coordinates | 160519..160824 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | NB671_RS28855 | Protein ID | WP_000813634.1 |
| Coordinates | 160299..160517 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB671_RS28825 (155376) | 155376..155723 | + | 348 | WP_000142449.1 | DUF6404 family protein | - |
| NB671_RS28830 (155743) | 155743..156333 | - | 591 | WP_000194553.1 | hypothetical protein | - |
| NB671_RS28835 (156333) | 156333..156590 | - | 258 | WP_000371889.1 | hypothetical protein | - |
| NB671_RS28840 (156918) | 156918..158021 | + | 1104 | WP_001127573.1 | nucleotide-binding protein | - |
| NB671_RS28845 (158051) | 158051..159181 | + | 1131 | WP_000542418.1 | DUF4238 domain-containing protein | - |
| NB671_RS28850 (159181) | 159181..159471 | + | 291 | WP_001229374.1 | hypothetical protein | - |
| NB671_RS28855 (160299) | 160299..160517 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NB671_RS28860 (160519) | 160519..160824 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NB671_RS28865 (160825) | 160825..161631 | + | 807 | WP_001593069.1 | site-specific integrase | - |
| NB671_RS28870 (161811) | 161811..162455 | + | 645 | WP_001144036.1 | ParA family protein | - |
| NB671_RS28875 (162542) | 162542..162850 | + | 309 | WP_000030198.1 | hypothetical protein | - |
| NB671_RS28885 (163816) | 163816..164178 | + | 363 | Protein_177 | plasmid segregation protein ParM | - |
| NB671_RS28890 (164171) | 164171..164587 | + | 417 | WP_001278813.1 | plasmid partitioning/stability family protein | - |
| NB671_RS28895 (164589) | 164589..165102 | - | 514 | Protein_179 | DUF4113 domain-containing protein | - |
| NB671_RS28900 (165163) | 165163..165267 | - | 105 | Protein_180 | AAA family ATPase | - |
| NB671_RS28905 (165269) | 165269..165592 | - | 324 | Protein_181 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..166337 | 166337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T247564 WP_001159868.1 NZ_CP098354:160519-160824 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|