Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6914..7557 Replicon plasmid p52977-161.7
Accession NZ_CP098353
Organism Klebsiella pneumoniae strain 52977_A1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NB671_RS27065 Protein ID WP_001044770.1
Coordinates 7141..7557 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NB671_RS27060 Protein ID WP_001261282.1
Coordinates 6914..7144 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB671_RS27020 (NB671_27020) 2142..2444 + 303 WP_004197636.1 hypothetical protein -
NB671_RS27025 (NB671_27025) 2884..3678 - 795 WP_004197635.1 site-specific integrase -
NB671_RS27030 (NB671_27030) 3876..4892 - 1017 WP_020315256.1 hypothetical protein -
NB671_RS27035 (NB671_27035) 4889..5212 - 324 WP_022644730.1 hypothetical protein -
NB671_RS27040 (NB671_27040) 5239..5634 - 396 WP_017899885.1 hypothetical protein -
NB671_RS27045 (NB671_27045) 5803..6108 - 306 WP_001568026.1 type II toxin-antitoxin system toxin CcdB -
NB671_RS27050 (NB671_27050) 6110..6328 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
NB671_RS27055 (NB671_27055) 6534..6957 - 424 Protein_9 hypothetical protein -
NB671_RS27060 (NB671_27060) 6914..7144 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NB671_RS27065 (NB671_27065) 7141..7557 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NB671_RS27070 (NB671_27070) 7631..7849 + 219 Protein_12 AAA family ATPase -
NB671_RS27075 (NB671_27075) 7914..8618 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
NB671_RS27080 (NB671_27080) 8671..9438 - 768 Protein_14 class 1 integron integrase IntI1 -
NB671_RS27085 (NB671_27085) 9594..10067 + 474 WP_004201280.1 trimethoprim-resistant dihydrofolate reductase DfrA14 -
NB671_RS27090 (NB671_27090) 10288..10440 + 153 Protein_16 plasmid mobilization relaxosome protein MobC -
NB671_RS27095 (NB671_27095) 10514..10579 + 66 Protein_17 EAL domain-containing protein -
NB671_RS27100 (NB671_27100) 10697..11461 + 765 WP_001389365.1 IS6-like element IS6100 family transposase -
NB671_RS27105 (NB671_27105) 11601..11666 - 66 Protein_19 EAL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaKPC-3 / blaSHV-182 - 1..161666 161666


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T247554 WP_001044770.1 NZ_CP098353:7141-7557 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT247554 WP_001261282.1 NZ_CP098353:6914-7144 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References