Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 6914..7557 | Replicon | plasmid p52980-161.7 |
Accession | NZ_CP098351 | ||
Organism | Klebsiella pneumoniae strain 52980_A4 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | NB670_RS27040 | Protein ID | WP_001044770.1 |
Coordinates | 7141..7557 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | NB670_RS27035 | Protein ID | WP_001261282.1 |
Coordinates | 6914..7144 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB670_RS26995 (NB670_26995) | 2142..2444 | + | 303 | WP_004197636.1 | hypothetical protein | - |
NB670_RS27000 (NB670_27000) | 2884..3678 | - | 795 | WP_004197635.1 | site-specific integrase | - |
NB670_RS27005 (NB670_27005) | 3876..4892 | - | 1017 | WP_020315256.1 | hypothetical protein | - |
NB670_RS27010 (NB670_27010) | 4889..5212 | - | 324 | WP_022644730.1 | hypothetical protein | - |
NB670_RS27015 (NB670_27015) | 5239..5634 | - | 396 | WP_017899885.1 | hypothetical protein | - |
NB670_RS27020 (NB670_27020) | 5803..6108 | - | 306 | WP_001568026.1 | type II toxin-antitoxin system toxin CcdB | - |
NB670_RS27025 (NB670_27025) | 6110..6328 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | - |
NB670_RS27030 (NB670_27030) | 6534..6957 | - | 424 | Protein_9 | hypothetical protein | - |
NB670_RS27035 (NB670_27035) | 6914..7144 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NB670_RS27040 (NB670_27040) | 7141..7557 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NB670_RS27045 (NB670_27045) | 7631..7849 | + | 219 | Protein_12 | AAA family ATPase | - |
NB670_RS27050 (NB670_27050) | 7914..8618 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
NB670_RS27055 (NB670_27055) | 8671..9438 | - | 768 | Protein_14 | class 1 integron integrase IntI1 | - |
NB670_RS27060 (NB670_27060) | 9594..10067 | + | 474 | WP_004201280.1 | trimethoprim-resistant dihydrofolate reductase DfrA14 | - |
NB670_RS27065 (NB670_27065) | 10288..10440 | + | 153 | Protein_16 | plasmid mobilization relaxosome protein MobC | - |
NB670_RS27070 (NB670_27070) | 10514..10579 | + | 66 | Protein_17 | EAL domain-containing protein | - |
NB670_RS27075 (NB670_27075) | 10697..11461 | + | 765 | WP_001389365.1 | IS6-like element IS6100 family transposase | - |
NB670_RS27080 (NB670_27080) | 11601..11666 | - | 66 | Protein_19 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaKPC-3 / blaSHV-182 | - | 1..161666 | 161666 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T247538 WP_001044770.1 NZ_CP098351:7141-7557 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |