Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4162456..4163075 Replicon chromosome
Accession NZ_CP098350
Organism Klebsiella pneumoniae strain 52980_A4

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NB670_RS20515 Protein ID WP_002892050.1
Coordinates 4162857..4163075 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NB670_RS20510 Protein ID WP_002892066.1
Coordinates 4162456..4162830 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB670_RS20500 (NB670_20500) 4157608..4158801 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NB670_RS20505 (NB670_20505) 4158824..4161970 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NB670_RS20510 (NB670_20510) 4162456..4162830 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NB670_RS20515 (NB670_20515) 4162857..4163075 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NB670_RS20520 (NB670_20520) 4163234..4163800 + 567 WP_002892030.1 maltose O-acetyltransferase -
NB670_RS20525 (NB670_20525) 4163772..4163912 - 141 WP_004147370.1 hypothetical protein -
NB670_RS20530 (NB670_20530) 4163933..4164403 + 471 WP_002892026.1 YlaC family protein -
NB670_RS20535 (NB670_20535) 4164378..4165829 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NB670_RS20540 (NB670_20540) 4165930..4166628 + 699 WP_002892021.1 GNAT family protein -
NB670_RS20545 (NB670_20545) 4166625..4166765 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NB670_RS20550 (NB670_20550) 4166765..4167028 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T247532 WP_002892050.1 NZ_CP098350:4162857-4163075 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT247532 WP_002892066.1 NZ_CP098350:4162456-4162830 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References