Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4162456..4163075 | Replicon | chromosome |
| Accession | NZ_CP098350 | ||
| Organism | Klebsiella pneumoniae strain 52980_A4 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NB670_RS20515 | Protein ID | WP_002892050.1 |
| Coordinates | 4162857..4163075 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NB670_RS20510 | Protein ID | WP_002892066.1 |
| Coordinates | 4162456..4162830 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB670_RS20500 (NB670_20500) | 4157608..4158801 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NB670_RS20505 (NB670_20505) | 4158824..4161970 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NB670_RS20510 (NB670_20510) | 4162456..4162830 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NB670_RS20515 (NB670_20515) | 4162857..4163075 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NB670_RS20520 (NB670_20520) | 4163234..4163800 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NB670_RS20525 (NB670_20525) | 4163772..4163912 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NB670_RS20530 (NB670_20530) | 4163933..4164403 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NB670_RS20535 (NB670_20535) | 4164378..4165829 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NB670_RS20540 (NB670_20540) | 4165930..4166628 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NB670_RS20545 (NB670_20545) | 4166625..4166765 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NB670_RS20550 (NB670_20550) | 4166765..4167028 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247532 WP_002892050.1 NZ_CP098350:4162857-4163075 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT247532 WP_002892066.1 NZ_CP098350:4162456-4162830 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |