Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 814692..815349 | Replicon | chromosome |
| Accession | NZ_CP098347 | ||
| Organism | Klebsiella pneumoniae strain 52984_A8 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NB669_RS04075 | Protein ID | WP_002916310.1 |
| Coordinates | 814939..815349 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NB669_RS04070 | Protein ID | WP_002916312.1 |
| Coordinates | 814692..814958 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB669_RS04045 (NB669_04045) | 809848..811281 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| NB669_RS04050 (NB669_04050) | 811400..812128 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NB669_RS04055 (NB669_04055) | 812178..812489 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
| NB669_RS04060 (NB669_04060) | 812653..813312 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| NB669_RS04065 (NB669_04065) | 813463..814446 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| NB669_RS04070 (NB669_04070) | 814692..814958 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NB669_RS04075 (NB669_04075) | 814939..815349 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NB669_RS04080 (NB669_04080) | 815356..815877 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| NB669_RS04085 (NB669_04085) | 815978..816874 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NB669_RS04090 (NB669_04090) | 816897..817610 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NB669_RS04095 (NB669_04095) | 817616..819349 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T247500 WP_002916310.1 NZ_CP098347:814939-815349 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |