Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 54867..55603 Replicon plasmid p53009-167.9
Accession NZ_CP098346
Organism Klebsiella pneumoniae strain 53009_G1

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NB668_RS28400 Protein ID WP_003026803.1
Coordinates 55121..55603 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NB668_RS28395 Protein ID WP_003026799.1
Coordinates 54867..55133 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB668_RS28350 (NB668_28345) 50929..51291 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
NB668_RS28355 (NB668_28350) 51341..51691 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NB668_RS28360 (NB668_28355) 52049..52318 + 270 WP_004152102.1 hypothetical protein -
NB668_RS28365 (NB668_28360) 52306..52881 + 576 WP_004152103.1 hypothetical protein -
NB668_RS28370 (NB668_28365) 52912..53406 + 495 WP_004152104.1 DNA-binding protein -
NB668_RS28375 (NB668_28370) 53450..53818 + 369 WP_004152105.1 hypothetical protein -
NB668_RS28380 (NB668_28375) 53852..54055 + 204 WP_004152106.1 HHA domain-containing protein -
NB668_RS28385 (NB668_28380) 54104..54361 + 258 WP_004152107.1 hypothetical protein -
NB668_RS28390 (NB668_28385) 54437..54691 + 255 WP_004152108.1 hypothetical protein -
NB668_RS28395 (NB668_28390) 54867..55133 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NB668_RS28400 (NB668_28395) 55121..55603 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NB668_RS28405 (NB668_28400) 55815..57161 + 1347 WP_020314316.1 ISNCY family transposase -
NB668_RS29030 57322..57453 + 132 WP_004218042.1 hypothetical protein -
NB668_RS28410 (NB668_28405) 57662..58827 - 1166 Protein_60 IS3 family transposase -
NB668_RS28415 (NB668_28410) 59004..59966 - 963 WP_004152113.1 zinc metalloprotease HtpX -
NB668_RS28420 (NB668_28415) 59953..60441 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 - 1..167851 167851


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T247496 WP_003026803.1 NZ_CP098346:55121-55603 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT247496 WP_003026799.1 NZ_CP098346:54867-55133 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References