Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 42104..42747 Replicon plasmid p53009-126.3
Accession NZ_CP098345
Organism Klebsiella pneumoniae strain 53009_G1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NB668_RS27575 Protein ID WP_001044770.1
Coordinates 42104..42520 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NB668_RS27580 Protein ID WP_001261282.1
Coordinates 42517..42747 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB668_RS27540 (NB668_27535) 38514..38783 + 270 WP_000339857.1 hypothetical protein -
NB668_RS27545 (NB668_27540) 38960..39826 - 867 WP_004118283.1 replication initiation protein -
NB668_RS27550 (NB668_27545) 40356..40460 + 105 WP_032409716.1 hypothetical protein -
NB668_RS27555 (NB668_27550) 40589..40687 + 99 Protein_41 hypothetical protein -
NB668_RS27560 (NB668_27555) 40818..40988 - 171 Protein_42 serine hydrolase -
NB668_RS27565 (NB668_27560) 41043..41747 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NB668_RS27570 (NB668_27565) 41812..42030 - 219 Protein_44 AAA family ATPase -
NB668_RS27575 (NB668_27570) 42104..42520 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NB668_RS27580 (NB668_27575) 42517..42747 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NB668_RS27585 (NB668_27580) 42704..43164 + 461 Protein_47 hypothetical protein -
NB668_RS27590 (NB668_27585) 43292..43612 + 321 WP_004197770.1 hypothetical protein -
NB668_RS27595 (NB668_27590) 43842..43976 + 135 Protein_49 hypothetical protein -
NB668_RS27600 (NB668_27595) 44004..44333 + 330 WP_004197773.1 hypothetical protein -
NB668_RS27605 (NB668_27600) 44382..45200 + 819 WP_004197776.1 hypothetical protein -
NB668_RS27610 (NB668_27605) 45200..45982 + 783 WP_004197768.1 site-specific integrase -
NB668_RS27615 (NB668_27610) 46149..47111 + 963 WP_004197772.1 Abi family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(6')-Ib / ant(3'')-Ia / cmlA1 / aadA2 - 1..126321 126321
- flank IS/Tn - - 41043..41747 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T247495 WP_001044770.1 NZ_CP098345:c42520-42104 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT247495 WP_001261282.1 NZ_CP098345:c42747-42517 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References