Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5464194..5464819 | Replicon | chromosome |
| Accession | NZ_CP098340 | ||
| Organism | Klebsiella pneumoniae strain 53015_G7 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | NB667_RS26875 | Protein ID | WP_002882817.1 |
| Coordinates | 5464194..5464577 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | NB667_RS26880 | Protein ID | WP_004150355.1 |
| Coordinates | 5464577..5464819 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB667_RS26860 (NB667_26865) | 5461560..5462462 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| NB667_RS26865 (NB667_26870) | 5462459..5463094 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NB667_RS26870 (NB667_26875) | 5463091..5464020 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| NB667_RS26875 (NB667_26880) | 5464194..5464577 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NB667_RS26880 (NB667_26885) | 5464577..5464819 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| NB667_RS26885 (NB667_26890) | 5465024..5465941 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
| NB667_RS26890 (NB667_26895) | 5465955..5466896 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| NB667_RS26895 (NB667_26900) | 5466941..5467378 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| NB667_RS26900 (NB667_26905) | 5467375..5468235 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
| NB667_RS26905 (NB667_26910) | 5468229..5468828 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T247479 WP_002882817.1 NZ_CP098340:c5464577-5464194 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |