Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4256351..4256970 Replicon chromosome
Accession NZ_CP098340
Organism Klebsiella pneumoniae strain 53015_G7

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NB667_RS21080 Protein ID WP_002892050.1
Coordinates 4256752..4256970 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NB667_RS21075 Protein ID WP_002892066.1
Coordinates 4256351..4256725 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB667_RS21065 (NB667_21065) 4251503..4252696 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NB667_RS21070 (NB667_21070) 4252719..4255865 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NB667_RS21075 (NB667_21075) 4256351..4256725 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NB667_RS21080 (NB667_21080) 4256752..4256970 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NB667_RS21085 (NB667_21085) 4257129..4257695 + 567 WP_002892030.1 maltose O-acetyltransferase -
NB667_RS21090 (NB667_21090) 4257667..4257807 - 141 WP_004147370.1 hypothetical protein -
NB667_RS21095 (NB667_21095) 4257828..4258298 + 471 WP_002892026.1 YlaC family protein -
NB667_RS21100 (NB667_21100) 4258273..4259724 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NB667_RS21105 (NB667_21105) 4259825..4260523 + 699 WP_002892021.1 GNAT family protein -
NB667_RS21110 (NB667_21110) 4260520..4260660 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NB667_RS21115 (NB667_21115) 4260660..4260923 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T247475 WP_002892050.1 NZ_CP098340:4256752-4256970 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT247475 WP_002892066.1 NZ_CP098340:4256351-4256725 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References